dChan
Anonymous ID: c74dc4 Q Research General #26948: Nothing Can Stop What Is Comfy Edition Nov. 17, 2024, 10:22 p.m. No.22008120   🗄️.is 🔗kun

Welcome to Q Research General

 

We are researchers who deal in open-source information, reasoned argument, and dank memes. We do battle in the sphere of ideas and ideas only. We neither need nor condone the use of force in our work here.

 

"We hold these truths to be self-evident: that all men are created equal; that they are endowed by their Creator with certain unalienable rights; that among these are life, liberty, and the pursuit of happiness."

 

VINCIT OMNIA VERITAS | SEMPER FIDELIS | WWG1WGA | QRESEARCH

 

Q's Latest Posts

>>18284019 Nov. - Dec. 2022

 

Q's Private Board

>>>/projectdcomms/ & Q's Trip-code: Q!!Hs1Jq13jV6

 

Find Q drops here

Qresear.ch/q-posts, Qanon.pub, Qalerts.pub, OperationQ.pub. Qposts.online, 8kun.top/qresearch/, Qalerts.app, Qalerts.net, douknowq.com/134295/Q-Anon-Pub.htm8ku

 

Q Posts Archives

* Q Map & Mirrors PDF: SCRIBD: https://www.scribd.com/document/419874308/Q-Anon-The-Storm-X-VII?secret_password=55SQ1tCYhuNR8ESzm50u

* Q Posts Archive, Searchable, interactive with user-explanations: qanon.pub qanon.app

* Q Posts Archive + RSS, Searchable, Analytics, Offsite Bread Archive: qanon.news

* Q Raw Text Dumps: q-clock.com/q_raw.txt

* Q Original, full-size images Q has posted: https://postimg.cc/gallery/29wdmgyze/

* Q Research Memo & OIG Report Links: 8kun.top/qresearch/res/426641.html#427188

* Q Research Notables: Archive Board >>>/qnotables/

* Q Adjacent infographs and moar: https://deepstatemappingproject.com/

 

Q Research Board

Key Resources below. Check DOUGH RESOURCES thread for more: >>17225239

New to QR?

>>17240320 Welcome to Q Research | >>20424387 Board Info

Meme Warfare

MEME WARRIOR UI 1.3 #240904: https://archive.is/3Pe0E

Board History

>>17242392 Q Encyclopedia & >>17242386 Q Video by Archive Anon

TOR Access

TOR URL: http://w7m432cocr665kf5tlpcxojwldajr3njd2etcxwhpbrt44eemuxhp7ad.onion/qresearch/catalog.html

TOR Banner: https://www.youtube.com/watch?v=MLCupx1UExg

Anonymous ID: c74dc4 Nov. 17, 2024, 10:23 p.m. No.22008125   🗄️.is 🔗kun

International Q Research Threads

>>21755366 Australia #38

>>21503242 Brazil #1

>>21929052 Canada #66

>>21284558 France #8

>>21435975 Germany #107

>>21637872 Japan #25

>>16694250 Nederland #10

>>21452596 QAJF #2

>>21350861 Scotland #11

>>21699204 Singapore #1

>>20969267 South Africa #13

>>19804572 UK #51

 

GLOBALS

KNOW YOUR BUNKER = https://endchan.org/qrbunker/catalog.html

>>17322509, >>19089065 Baking Tools & Guidelines

>>20022853 Posting Guidelines for Anons

 

IMPORTANT!Help support 8KUN

>>21438634, >>21189998, >>21462480, >>21190032, >>21543513 @thejimwatkins: Is it worth keeping 8kun online?? (Make bitcoin pmts via Proto)

>>18024378, >>18561054, >>21587855 PROTO Instructions & CONTACT info for Q's or problems

 

Please Support The Watkins Project #8KUN [DONATE LINK ABOVE]

Follow The Owner: Jim Watkins x.com/thejimwatkins/

Bookmark Watkins Report: https://watkinsreport.com/

Advertise Here: ads@isitwetyet.com

Donate Bitcoin: 1KiJD44WeWKaDb4Newr7bDXadtGn21ACqY

Proto Membership: https://shop.isitwetyet.com/p/Proto-membership/ (Coin Accepted)

Send Anonymous Money Orders: Is It Wet Yet, Inc at 2118 Wilshire Blvd #403 Santa Monica, CA. 90403

Buy Merchandise: (Coin Accepted)

  • https://shop.isitwetyet.com/ (proto levels / donations)

  • https://shoppers.isitwetyet.com/ (misc.)

  • https://www.p2pprinting.com/8kun (clothing)

  • https://goodstuffcoffee.com/8kuncoffee/ (covfefe)

 

ANONS: Stay positive, Eyes on the GOAL, not the OBSTACLES!

 

NOTABLES ARE NOT ENDORSEMENTS

 

#26947 >>22007210

>>22007233 GERMANY'S GOVERNMENT CRISIS – Everything you need to know! | Feli from Germany

>>22007255 Vivek Ramaswamy: Trump’s Sweeping Victory, & What It Means for the Future of Government Bureaucracy

>>22007282 Palestinian Foreign Ministry: international community bears responsibility for ongoing massacres against Palestinians

>>22007284 MAGA Takeover Or Israel First? Blumenthal Vs. Beattie To Clash Over Trump Appointments

>>22007296 Biden greenlights Kiev's use of long-range missiles deep into Russia

>>22007342 Elon Musk - Some deep truths here

>>22007385 ‘Australia needs its own DOGE’: One in five workers is a public servant as wages bill hits $232 billion

>>22007386, >>22007413 Donald Trump plays golf with Jay Monahan, attends UFC event with Yasir Al-Rumayyan in recent days

>>22007390 Thune making a move.

>>22007422 Police are actively investigating accusations of serious sexual misconduct against former shock jock Alan Jones

>>22007509 Israel's once-powerful crime boss Yitzhak Abergil faces life in prison as Supreme Court rejects his final appeal in Case 512.

>>22007537 On March 1, 2018, The Washington Times published an opinion column by Lyons about Democratic Party staffer Seth Rich's unsolved murder in Washington D.C

>>22007539 Masked Men waving Swastika flags march through downtown Columbus, Ohio

>>22007657 It is stated that the Ridvan Corps carried out a suicide attack and many MOSSAD elements were affected by this attack.

>>22007679 Ex-CDC director Robert Redfield believes COVID-19 may have been born in a North Carolina laboratory as part of a secret biodefense program.

>>22007704 Former CDC Director Dr. Redfield Opens Up About Pandemic Lessons and Public Health

>>22007739 What is Bluesky, the fast-growing social platform welcoming fleeing X users?

>>22007746 A man wearing Israeli army unifrom was filmed harrasing and provoking people in a mosque in Houston, Texas.

>>22007893 Israel's rape crisis centers report 81% of sex offense cases closed without indictment in 2023, with most victims being minors attacked by people they knew.

>>22007981 Louis Farrakhan - Talks about Trump destroying Enemy of the Blacks

>>22007982, >>22008016 Hopefully Donald Trump Will Address You: Chicago Residents Slam Mayor Brandon Johnson for Tax Hike Proposal to Pay for Invaders wrongly called migrant Crisis

>>22007985 smith mundt modernization act owned CNN and MS Smith Mundt Modernization Act Owned NBC s collapse stuns: prime-time viewers under 75k, weekends below 30k!

>>22007986 ‘Trump Dance’ Celebrations Explode Across NFL

>>22008068 Masked burglars smashed down security barrier and scaled Windsor Castle estate fence 'while Prince William and Princess Kate were asleep at home with their children'

>>22008087 MSNBC host Joe Scarborough says that he believes vaccines can cause autism, while hosting RFK Jr. on his show:

>>22008121 #26847

 

#26946 >>22006259

>>22006334 NYC medical examiner still identifying 9/11 victims' remains: "If there's DNA, we're going to find it"

>>22006342, >>22006351, >>22006683, >>22006893, >>22006959 @realDonaldTrump Brendan Carr named Chair of FCC

>>22006352, >>22006818, >>22006823, >>22006844, >>22007011, >>22007045, >>22007106, >>22007181 Putin's motorcade has arrived aggressively at the Kremlin. These rapid arrivals highlight something extremely important. 🇺🇸/NATO excursions into Russia???US weaponry

>>22006361 mpox fear pron

>>22006378 Vivek Ramaswamy lays out vision for DOGE

>>22006412 India Announces 'Historic' Long-Range Hypersonic Missile Test Flight

>>22006440, >>22006363 FDA to pull phenylephrine, ineffective

>>22006484 Trump team will ‘make sure’ every nominee gets through

>>22006507 A packed war court shuttle has arrived from Guantánamo Bay with the 9/11 case travelers and base families getting off the island for the coming Thanksgiving holiday.

>>22006713, >>22006750 Turtle says no recess appts kek

>>22006724 Musk is Q??? Trending???

>>22006739, >>22006771 Falcon 9 lifts off from pad 39A in Florida

>>22006845 Musk on Mars

>>22006866 Musk reacts to Biden reportedly allowing deep strikes on Russia

>>22006982 Texas Braces for Final Biden-Era Migrant Surge, Illinois Extends Welcome Mat

>>22006995 OKLAHOMA LAUNCHES PILOT DEPORTATION PROGRAM

>>22007017 Kari Lake nears Senate race concession

>>22007130 military n Musk

>>22007161 @realDonaldTrump What a great week this has been. Perhaps the most successful Election results in Republican Party history! MAKE AMERICA GREAT AGAIN. Thank you!!!

>>22007164 @realDonaldTrump We’re coming up on the five year anniversary of Covid, and if you recall, under President Trump’s leadership, we had incredible public health policies. President Trump’s unparalleled creation of Operation Warp Speed was one like we’ve never seen before! Dr. Janette Neishewat, FoxNews

#26946

 

#26945 >>22005404

>>22005871, >>22005892, >>22005921, >>22005442, >>22005463, >>22005562, >>22005601, , >>22005709, >>22006187, >>22005914, >>22005921, >>22005966, >>22006037 Elon Musk Activated: QNN Pepe News meme 5:20 PM· Nov 17, 2024 Q 1720 When does a bird sing?

>>22005782, >>22005820 Elon Musk: Easter Island meme, Washington DC Pindar monument

>>22005427 Biden turned off his beacon

>>22005436 Trump calls for investigation into disgraced Iowa pollster Ann Selzer after her pre-Election Day poll showed Harris leading the state by 3 points

>>22005451 Matt Gaetz says what everyone else is too afraid to say, The Ukraine War is “to launder money through” (Cap 0:39)

>>22005509, >>22005631 @USNavy The sun never sets on the #USNavy. @GW_CVN73 transits the Pacific Ocean

>>22005597, >>22005639, >>22005642 Australian Alan Jones is arrested over allegations he indecently assaulted, groped or inappropriately touched multiple young men

>>22005629 Kim Jong Un Calls For War Preparations

>>22005641, >>22006070, >>22005813, >>22005697, >>22005874 Biden Allows Ukraine to Strike Russia With Long-Range U.S. Missiles, Alex Soros, openly celebrating the potential of US long-range weapons being fired into Russia

>>22005555 Green-new-scam: Office of Fossil Energy and Carbon Management

>>22005727, >>22005736, >>22005748, >>22005760 Governor JB Pritzker pushes Transgender Awareness Week

>>22005890 Bluesky bans you for common sense (Cap 0:22)

>>22005937 President Donald J.Trump: Great job on FoxNews today by GOPAC CHAIRMAN David Avella

>>22005766 Trump's Cabinet: 15 out of 27 Announced

>>22006048 Speaker Mike Johnson on Matt Gaetz strikes fear not because of the allegations against him but because he could fix a broken system (Cap 1:36)

>>22006072, >>22006084 Parents arrested outside Washington school after attempted 'honor killing' of their daughter

>>22006144 @JDVance: AP is attacking Pete Hegseth for having a Christian motto tattooed on his arm

>>22006225 #26945

 

#26944 >>22004590

>>22004597 British folk rock band Mumford & Sons @MrWinMarshall reveals to Americans that people are being imprisoned in the UK and EU for politically incorrect social media posts

>>22004602 After Burning Through More Than a Billion Dollars, the Kamala Harris Campaign is Now Struggling to Pay Senior Staffers

>>22004641 Bill Gates and Reid Hoffman know each other thru Epstein. Epstein reportedly bought shares in LinkedIn before Gates bought it from Hoffman. Eat healthy cows. Eat real beef. Live healthy.

>>22004652 Secretary Antony Blinken United States building a new LIMA passenger train line fore transportation of 200,000 people daily, We just don’t have the money to help people in western NC. Sorry.

>>22004678, >>22004697, >>22004713 Trump's dance continues to spread through the NFL. Today (so far):

>>22004621, >>22004622, >>22004624, >>22004627, >>22004629 WHO IS JOE BOLTON? Election Systems & Software (ES&S) and or Microvote

>>22004707 It's never notable unless you fulfill the requirements, so stop posting things on here without the sauce, if you think its worthy of notice

>>22004640, >>22004715 Biden Allows Ukraine to Strike Russia With Long-Range U.S. Missiles

>>22004717, >>22004727, >>22004774 Xi vows to work with Trump team as he meets Biden in Peru

>>22004729 Duke University's @DukeSanford found that data brokers sell data on military personnel for as little as $.12 to unknown buyers.

>>22004737 @DonaldJTrumpJr The Military Industrial Complex seems to want to make sure they get World War 3 going before my father has a chance to create peace and save lives

>>22004738, >>22004708, >>22004797 Blue Sky Comms: Rachel Chandler and Comey

>>22004749, >>22005038 Jen Psaki Admits Dems Are ‘In The Wilderness’ Without A ‘Clear Leader Of The Party’

>>22004800 Pentagon responds to RT's request for confirmation of Biden's authorization for Ukraine to use ATACMS to strike Russia

>>22005178 @KariLake Every time a celebrity announces they’re ‘leaving America,’ I can’t help but wonder: is this an indication that they know the Epstein list finally dropping?

TBC

 

Previously Collected

>>22003591 #26942, >>22004574 #26943

>>22001100 #26939, >>22002105 #26940, >>22002792 #26941

>>21998275 #26936, >>21999198 #26937, >>22000411 #26938

>>21995617 #26933, >>21996324 #26934, >>21997252 #26935

 

Aggregators: https://qresear.ch | https://qnotables.com | https://qproofs.com

Q Research Notables Archive Board >>>/qnotables/

Q Research Notables #25: Time >>21641140

Anonymous ID: 000000 Nov. 17, 2024, 10:36 p.m. No.22008210   🗄️.is 🔗kun   >>8483 >>8577 >>8773 >>8877 >>8911

Sequivity Stakeholders

 

https://www.merck-animal-health-usa.com/species/swine/sequivity

 

https://www.merck-animal-health.com/wp-content/uploads/2023/05/Merck-Sequivity-Statement.pdf

 

Nov 3, 2023 Sequivity IAV-S NA is labeled for pigs as young as 3 days of age. "Because of this, the vaccine gives producers more flexibility to include in their growing pig vaccination programs" O'Brien says. "We recognize that IAV-S is prevalent within U.S. swine herds and that the highest economic impact occurs in pigs infected with IAV-S at an early age

 

2018 https://www.youtube.com/watch?v=m7oc0THI_OE

2019 https://www.youtube.com/watch?v=jSQKIQt9RKc

Anonymous ID: ec1848 Nov. 17, 2024, 10:42 p.m. No.22008223   🗄️.is 🔗kun   >>8230

>>22008218

When you hear people use the word "Power" or "Powerful" referring to something close to themselves, or themselves, its word normally reserved for the weak. Females use the word fluently which is an indicator and should be a warning to get the fuck away from them.

Anonymous ID: d54574 Nov. 17, 2024, 10:44 p.m. No.22008226   🗄️.is 🔗kun   >>8325

Central Algorithm works by flags, which are Boolean values of any type:

True False

Yes No

0 1

Symbol or absence of symbol

 

Depending on the flags indicated, the logic and paths are executed into a result set. What is returned is the scalar value of each flag into a concerted whole.

 

Conservative yes || no

White 0 || 1

Financial_Threat * || null

Secrets_Threat true || false

 

Each may return a partial that is threaded through to create an informational screen that the target reads.

 

The more that you know.

Anonymous ID: 897d2b Nov. 17, 2024, 10:50 p.m. No.22008230   🗄️.is 🔗kun   >>8234

>>22008218

>>22008223

power is a aphrodisiac

Craved by psychopath and those who gravitate towards it,

Women want to use male power to do their bidding with violence.

The elites use women because they are easily manipulated.

example useful feminist idiots.

Big Subject which will not be answered by Trump getting into power.

One battle at a time.

They collectively abandoned their children and God given gift of child birth and their protectors for state handouts and enforcements.

Anon is not staying for this one.

God will judge them if they do not repent.

Anonymous ID: 76774e Nov. 17, 2024, 10:58 p.m. No.22008241   🗄️.is 🔗kun   >>8246

KEK. What happens when the fake is no longer enough? When the play acting fools no one? When all the patterns they have are seen? When its all just an NPC loop? What happens then?

Anonymous ID: 4578a2 Nov. 17, 2024, 11 p.m. No.22008242   🗄️.is 🔗kun   >>8245 >>8483 >>8577 >>8773 >>8877 >>8911

https://www.outkick.com/sports/nfl-cbs-caught-editing-trump-dance-out-raiders-touchdown-celebration

 

NFL On CBS Caught Editing Trump Dance Out Of Raiders Touchdown Celebration

Armando Salguero

PublishedNovember 17, 2024 3:44 PM EST|UpdatedNovember 17, 2024 3:44 PM EST

Anonymous ID: 897d2b Nov. 17, 2024, 11:05 p.m. No.22008246   🗄️.is 🔗kun   >>8341 >>8474 >>8480 >>8483 >>8577 >>8773 >>8877 >>8911

>>22008241

5g activation attack incoming for the vaxxed or they will go weather warfare last option nuclear.

-—

ARCHIVING - JUNE 20 2016 VIDEO, TOM WHEELER ON THE DEPLOYMENT OF 5G, IT IS TOO IMPORTANT TO DELAY THE DEPLOYMENT OF THIS TECH WITH SAFETY CHECKS !!!

FCC CHAIRMAN ON 5G WE WONT STUDY IT REGULATE IT HAVE STANDARDS FOR IT IGNORES HEALTH s 1

https://youtu.be/nIDW6n539GU

Anonymous ID: 897d2b Nov. 17, 2024, 11:12 p.m. No.22008257   🗄️.is 🔗kun   >>8483 >>8577 >>8773 >>8877 >>8911

>>22008239

text for those who want to share

ARCHIVING - THE SILENT ENEMY - A POEM BY AN UNKNOWN AUTHOR !!!

Note: This includes everyone, reminder farmers protest tomorrow in London !!

==

https://x.com/Fxhedgers/status/1858312105373429876

THIS👇

Tax his land, Tax his bed,

Tax the table, At which he's fed.

Tax his tractor, Tax his mule,

Teach him taxes are the rule.

Tax his work, Tax his pay,

He works for peanuts anyway!

Tax his cow, Tax his goat, Tax his pants, Tax his coat.

Tax his ties, Tax his shirt, Tax his work, Tax his dirt.

Tax his tobacco, Tax his drink, Tax him if he Tries to think.

Tax his cigars, Tax his beers, If he cries Tax his tears.

Tax his car, Tax his gas, Find any way To tax his ass!

Tax him all he has, then let him know

That you won't be done Till he has no dough.

When he screams and when he hollers;

Then tax him more, take all his dollars

Then tax his coffin, Tax his grave,

Tax the sod in Which he's laid…

Put these words Upon his tomb:

‘Taxes drove me to my doom…'

When he's gone, Do not relax,

It's time to apply Inheritance Tax.

Author Unknown

Anonymous ID: e4caf6 Nov. 17, 2024, 11:17 p.m. No.22008271   🗄️.is 🔗kun   >>8321

Dr. Jay Bhattacharya: "HHS commissioned a public relations firm named Fors Marsh Group in September of 2020, and then spent almost a billion dollars over the course of the Biden administration, essentially to propagandize the American public."

 

"Their themes were very, the goal, the main goal was to tell people that if you don't get the COVID vaccine, you are unclean. And they fear mongered about the risk to kids. They pushed forward false ideas about natural immunity, where they said essentially denied its existence."

 

"They did everything they possibly could to tell you about the benefits of the vaccine, but never once told you about the potential harms, right? So for instance, the side effects of myocarditis for young men, as best I can tell, never came up once in any of their ads."

 

"And they put these ads into like the most vulnerable populations. It essentially was a billion dollars spent by the taxpayer to propagandize the American people."

 

https://x.com/newstart_2024/status/1858404437644996775

Anonymous ID: c42283 Nov. 17, 2024, 11:19 p.m. No.22008275   🗄️.is 🔗kun

>>22008209

All they need to do is require the stations to spend as much time on retraction of their lies as they do spewing them & it will stop. I think Trump also wants them to be paying for their licenses, prolly a % based on advertisers.

Anonymous ID: 049dff Nov. 17, 2024, 11:25 p.m. No.22008284   🗄️.is 🔗kun

BIden and Harris should be impeached immediately.

Everyone knows he's demented, but yet they allow him to start WW3 by green lighting Ukraine to use OUR long distance missiles to attack inside Russia?

Come on Republicans! Do your duty!

Anonymous ID: 32f594 Nov. 17, 2024, 11:26 p.m. No.22008287   🗄️.is 🔗kun

After Musk literally lives in Mar a Lago he is posting the clearest Q (related) meme he ever posted! Was he talking about the Clearance Patriot with Q+ (and got his answer?)?

Anonymous ID: 1ed4c9 Nov. 17, 2024, 11:26 p.m. No.22008289   🗄️.is 🔗kun   >>8294 >>8390 >>8417

>>22008282

 

I am not asking you to do anything because the vast majority won't because they are scared and understandably so. I am asking what did all this standing down buy us? These people continued in their crimes, and looted and enriched themselves even more.

Anonymous ID: 897d2b Nov. 17, 2024, 11:30 p.m. No.22008294   🗄️.is 🔗kun   >>8310

>>22008289

We are researchers who deal in open-source information, reasoned argument, and dank memes. We do battle in the sphere of ideas and ideas only. We neither need nor condone the use of force in our work here.

Anonymous ID: 6e611d Nov. 17, 2024, 11:31 p.m. No.22008295   🗄️.is 🔗kun

>>22008247

There are 16 other "Intelligence" agencies. Half of them are under the military. How about not replacing it, declaring SES a terrorist organization and deveining, disbarring and prosecuting Merrick Garland's Treasonous DOJ, including the gangsters, spies and Traitors in Congress?

 

Got any advisory positions for these fine people?

https://en.wikipedia.org/wiki/William_K._Black

https://en.wikipedia.org/wiki/Brooksley_Born

Anonymous ID: 8f65ee Nov. 17, 2024, 11:42 p.m. No.22008306   🗄️.is 🔗kun

THE GLOBAL MARKETS ARE FREAKING OUT OF THE TREASURY APPOINTMENT BY TRUMP, THEY WANT TO KEEP THE STATUS QUO

Note: china, india and the developing nations which have been using that status to suck out wealth and import jobs with flooding the jobs markets, global trading is done with dollars still, brics is a global alternative but will not work unless the b.i.s dismantle international trading. all currencies have to go to the dollar before payment exchange.

=

Trump & Fed Risks Weigh on Treasuries | Full Episode | Insight with Haslinda Amin 11/18/2024

https://youtu.be/7wueid3h278

-–

18 Nov 2024

Insight with Haslinda Amin, a daily news program featuring in-depth, high-profile interviews and analysis to give viewers the complete picture on the stories that matter. The show features prominent leaders spanning the worlds of business, finance, politics and culture.

 

Chapters:

00:01:17 - Treasuries see 2024 gains dwindle

00:02:53 - Jamieson Coote Bonds CIO Charlie Jamieson on bonds

00:08:24 - Jamieson on Trump win, Treasury Secretary candidates

00:10:23 - Aluminum soars as China scraps tax sweetener

00:10:51 - EXCLUSIVE: Hindalco Industries MD Satish Pai on aluminum prices

00:26:29 - EXCLUSIVE: HKEX CEO Bonnie Chan on Stock Connect program

00:32:19 - AAPA Director General Subhas Menon on supply chain issues

00:42:27 - Menon on airlines' sustainability goals

-—

Anonymous ID: dfc903 Nov. 17, 2024, 11:46 p.m. No.22008310   🗄️.is 🔗kun   >>8317

>>22008294

 

I am a Patriot, and if need be, I will fight and defend this country and even bear arms. I will never ask anyone to grow a backbone, they will complain forever. This only ends when someone takes a hold of evil. No war ever ended by saying please stop, we caught you doing wrong.

Anonymous ID: 3a1819 Nov. 17, 2024, 11:47 p.m. No.22008311   🗄️.is 🔗kun   >>8313 >>8364 >>8786

RattleTrap 1776 

@derekjohnson

 

2017 to 2018 

 

Nov 18, 2024, 12:00 AM

https://truthsocial.com/@derekjohnson/posts/113502192429609322

 

Is this when it happened?

Have always wonder about this…

Anonymous ID: 3a1819 Nov. 17, 2024, 11:48 p.m. No.22008313   🗄️.is 🔗kun

>>22008311

@bpublius70

 

·

1h

Replying to @derekjohnson

When McCain was taken down the road, so was Biden. Regardless of when the actual execution took place in 2018, Biden 2.0 made perhaps his first appearance in May that same year. They were practicing the seamless transition. Biden 2.0 even started the speech in front of hospice nurses with, Sorry I'm late (aka dead). Comms everywhere.

Anonymous ID: 1cff89 Nov. 17, 2024, 11:49 p.m. No.22008316   🗄️.is 🔗kun

>>22008303

 

Moral high ground is a win but this doesn't end until someone takes hold of evil as in arrests. We have had the moral high ground for the last 30 years, didn't stop the killing of innocent lives.

Anonymous ID: 1cff89 Nov. 17, 2024, 11:52 p.m. No.22008324   🗄️.is 🔗kun   >>8332 >>8490

>>22008317

 

I understand, but remember, they will never quit, until we are dead, moral high ground or not. Do not expect assassination or genocide attempts to stop just because we won the office. They will double and triple their efforts.

Anonymous ID: 9553db Nov. 17, 2024, 11:56 p.m. No.22008338   🗄️.is 🔗kun   >>8353

>>22008332

 

Yeah , well, I should be with those in harms way, this happened on my watch but I couldn't wake people up. After they were kneeling to BLM, they finally started to wake. 2 Decades.

Anonymous ID: 9553db Nov. 17, 2024, 11:58 p.m. No.22008343   🗄️.is 🔗kun

>>22008333

 

Again, a stupid accusation with no explanation of where your logic is right and mine is wrong. That is your second stupid nebulous remark without any substance.

Anonymous ID: 0e2492 Nov. 18, 2024, midnight No.22008347   🗄️.is 🔗kun   >>8360

>>22008335

 

Yep, I know, I give them a challenge and they have legitimate response which proves they have no understanding at all. See that works? All they know, which makes them made, is that I revealed their algorithm in a clear concise way.

Anonymous ID: 905d7b Nov. 18, 2024, 12:02 a.m. No.22008351   🗄️.is 🔗kun   >>8419

Biscuits playing God can't just kill you. They need to somehow extract a confession that you're full of shit first, so they don't end up with a repeat of what happened two thousand years ago.

Anonymous ID: d02a67 Nov. 18, 2024, 12:03 a.m. No.22008353   🗄️.is 🔗kun   >>8357 >>8369

>>22008338

honestly nothing anon can or will say will make you understand the journey to this point.

taking on a 12000 year old death cult and a trillion dollar propaganda machine with all the strings of power at their disposal is not enough.

you can always do what this anon is going to do.

Anon is never going back and will do everything to melt into the background a surf the two systems.

That choice is also available if you know how.

Anonymous ID: e8a8a3 Nov. 18, 2024, 12:08 a.m. No.22008360   🗄️.is 🔗kun   >>8363

>>22008335

>>22008347

 

Sorry for the typos. Illegitimate. See how that works.

 

Nevertheless, the algo works by quickly scanning Boolean flags, which can be easily captured in a sequential array, then multi-threaded for each use case, finally threading to a factory method to piece all the pieces together into a whole informational screen or result set. This way they can target, millions of requests, simultaneously from just a single server for the consumption of the targets. The more you know.

 

Flags are also analog, hospitals have been known to mark paperwork with symbols for their cronies to know, who is on the butcher's block.

Anonymous ID: ec1848 Nov. 18, 2024, 12:10 a.m. No.22008363   🗄️.is 🔗kun   >>8376

>>22008360

>Flags are also analog, hospitals have been known to mark paperwork with symbols for their cronies to know, who is on the butcher's block.

What do you know about the Medical flagging?

Anonymous ID: 3a1819 Nov. 18, 2024, 12:11 a.m. No.22008365   🗄️.is 🔗kun   >>8405 >>8483 >>8577 >>8773 >>8877 >>8911

Patri0tsareinContr0l

@Patri0tsareinContr0l

 

It’s rare that I post a 7 minute video, but this entire interview is fantastic.

 

Sen. Bill Hagerty drops truth bombs on MSNBC about the weaponization of the DOJ and obliterates every single BS narrative Andrea Mitchell throws at him, even causing her to freeze and stumble over her words on multiple occasions.

 

“It’s amazing that you’re more upset about [Gaetz] allegations than you are about the weaponization of the Department of Justice.”

 

If you got the time and enjoy seeing the Fake News clowns look like complete fools, this is worth a watch.

 

7:24

https://1a-1791.com/video/s8/2/j/T/9/J/jT9Ju.caa.mp4

 

https://truthsocial.com/@Patri0tsareinContr0l/posts/113483483793831054

1PILOTORB1 ID: 5e7652 Nov. 18, 2024, 12:13 a.m. No.22008368   🗄️.is 🔗kun

THEHATREDISTERRIBLETHICKERTHANOILFATHER

IFEELBADFORWHOMEVERITISTHEYKNEW&MUSTHAVEDONEHORIDOUSTHINGS

DOYOUKNOWWHOTHISEVILWICKEDTORTURINGSPIRITIS?

IWOULDBETITISHERMOTHER

SHEISTHESUNGODRADEVIL

HASLYNNHASBEENTORTUREDABUSEDANDCONTROLLEDALLHERLIVESYOUPROTECTEDHER

HASHERMOTHERBEENAFTERMETODADFORMANYLIVESALSOAFTERYOUMADEME?

Anonymous ID: ccbdbf Nov. 18, 2024, 12:13 a.m. No.22008369   🗄️.is 🔗kun   >>8373

>>22008353

 

Thanks, but if you knew how much I revealed on how things work, you would understand, I was waiting for the rest to catch up. Take a look at the algo, I just revealed. It actually started, in digital form with multi-line phones against day traders and morphed into the Internet algo.

1PILOTORB1 ID: 5e7652 Nov. 18, 2024, 12:19 a.m. No.22008375   🗄️.is 🔗kun

MARKALWAYSINONITTOO?

OTHERHEAVENLYBROTHERSANDSISTERSTOO

RICHARDRESNICK

THETRAILORS?

AMIALMOSTDONEWITHMYFINALSSQQN

HOPETOSEEYOUANDLYNNANDFAMILYSQQNDADTHANKQFORTHISAWESOMETEST

Anonymous ID: 1ccd2c Nov. 18, 2024, 12:19 a.m. No.22008376   🗄️.is 🔗kun   >>8505

>>22008363

 

Watch for "Symbols" like I said in the central algorithm. Symbols resolve into more complex statements. These are called DSL's , domain specific languages. The police have their own, perp, 187, etc… Starbucks has their own, in a few short phrases can describe over 1,000 drink combinations. Hospitals have their own which may be general, or local to certain domains. The important point is to find them and by observations and interrogations, find their true meanings. I was told only one by a doctor, then realized, how often I had seen medical records with markings that had no meaning to me but it does to them. They stay under the radar this way.

Anonymous ID: 2a38b0 Nov. 18, 2024, 12:24 a.m. No.22008383   🗄️.is 🔗kun

>>22008145

BREAD IS GHOSTED

BREAD IS GHOSTED

BREAD IS GHOSTED

BREAD IS GHOSTED

BREAD IS GHOSTEDBREAD IS GHOSTEDBREAD IS GHOSTED

BREAD IS GHOSTED

BREAD IS GHOSTEDBREAD IS GHOSTED

BREAD IS GHOSTEDBREAD IS GHOSTEDBREAD IS GHOSTEDBREAD IS GHOSTED

BREAD IS GHOSTEDBREAD IS GHOSTEDBREAD IS GHOSTED

BREAD IS GHOSTED

BREAD IS GHOSTED

BREAD IS GHOSTED

BREAD IS GHOSTEDBREAD IS GHOSTED

Anonymous ID: e7fdab Nov. 18, 2024, 12:25 a.m. No.22008386   🗄️.is 🔗kun   >>8389

>>22008373

>touch grass.

 

Kek, my grass is bleached from cyanide and they broke 6 sprinkler heads and one spigot this year alone. I have God, just waiting for the rest to catch up, if ever.

Anonymous ID: 7f27c0 Nov. 18, 2024, 12:30 a.m. No.22008392   🗄️.is 🔗kun   >>8395 >>8400

>>22008389

 

Thanks for the advice, but remember, I have been targeted and fought this crime organization now for about 24 years, just about alone. They know who I am and where I live. This has taken a toll beyond what most can imagine. I was the one who told the board about gang stalking back when it first started.

Anonymous ID: 64187a Nov. 18, 2024, 12:37 a.m. No.22008397   🗄️.is 🔗kun   >>8403 >>8406 >>8407 >>8424

>>22008378

XXY

 

Haplogroup Q is thought to have originated in Central Asia or North Asia during of shortly after the Last Glacial Maximum (LGM, 26,000 to 19,000 years ago). Q descends from haplogroup P, which is also the ancestor of haplogroups R1a and R1b. Haplogroup Q quickly split into two main branches: Q1a and Q1b. The northern Q1a tribes expanded over Siberia as the climate warmed up after the LGM. Some Q1a crossed the still frozen Bering Strait to the American continent some time between 16,500 and 13,000 years ago. Q1b tribes stayed in Central Asia and later migrated south towards the Middle East.

 

Siberian & Native American Q1a

 

Many of clades of haplogroup Q1a are believed to have been brought by the Huns, the Mongols and the Turks, who all originated in the Altai region and around modern Mongolia. Haplogroup Q has been identified in Iron Age remains from Hunnic sites in Mongolia by Petkovski et al. (2006) and in Xinjiang by Kang et al. (2013). Modern Mongols belong to various subclades of Q1a, including by order of frequency Q1a2a1c (L330), Q1a1a1 (M120), Q1a1b (M25) and Q1a2a2 (YP4004).

 

Among those, the M25 subclade has been found in the North Caucasus (1000 year-old BZ640 subclade), in Poland and Hungary (1750 year-old BZ1000 subclade), in northern Ireland (YP1669 subclade), in Turkey, Iran and Pakistan (Y16840 subclade) and in Arabia (F5005 subclade).

 

Q1a is also the main paternal lineage of Native Americans. The testing of the genome of 12,600 year-old boy (known as Anzick-1) from Clovis culture in the USA confirmed that haplogroup Q1a2a1 (L54) was already present on the American continent before the end of the Last Glaciation. The vast maority of modern Native Americans belong to the Q1a2a1a1 (M3) subclade. As this subclade is exclusive to the American continent and the Anzick boy was negative for the M3 mutation, it is likely that M3 appeared after Q1a2a1 reached America.

 

South Asian Q1b2

 

In contrast with Q1b1, Q1b2 (Y1150) is found almost exclusively in the Indian subcontinent. The two Q1b branch split from each others some 15,000 years ago, during the Late Paleolithic period. Data is still sparse about this subclade, but is it reasonable to assume that it has been in South Asia at least since the end of the last Ice Age, long before the Indo-European migrations.

 

https://www.eupedia.com/europe/Haplogroup_Q_Y-DNA.shtml#distribution

Anonymous ID: db757c Nov. 18, 2024, 12:37 a.m. No.22008398   🗄️.is 🔗kun   >>8414

>>22008390

>Speaking out is not standing down.

 

Correct, but being anonymous is one thing, remember what they did to Mike Lindell just for talking about election fraud, they took his merchandise out of every store because they either own or control them. Mike didn't speak out about the real scams and atrocities. It is good that you do speak out, but some of us had to get the ball rolling after 911, and I have had a long train of abuses that most cannot imagine.

Anonymous ID: 3e34f0 Nov. 18, 2024, 12:41 a.m. No.22008401   🗄️.is 🔗kun   >>8412 >>8439 >>8483 >>8577 >>8773 >>8877 >>8911

Biden allows Ukraine to strike Russian territory with long-range US missiles

 

63 days…

 

Remember their meeting in the White House last week? Trump looked very unhappy while Biden had the biggest smile on his face, did Trump know Biden was going to do this in advance? I think he did, and now the escalation with Russia is about to hit new heights.

Anonymous ID: c94977 Nov. 18, 2024, 12:42 a.m. No.22008404   🗄️.is 🔗kun

>>22008395

>thank you for your service, and wisdom!

 

Don't thank me in reality, Thank God, because if he never showed up, we all would have fell for the false narrative and that would have been the end for all of us. They really went for it. God strengthened me and urged me on. I am not stupid, I knew they would kill me for destroying their genocide plans and let me tell you for a fact, 3 times they tried to kill me on that horrific day. If I never saw God's Light, I would of had an excuse, but I am accountable.

Anonymous ID: ec1848 Nov. 18, 2024, 12:45 a.m. No.22008406   🗄️.is 🔗kun

>>22008397

It all ends at the same place anon. Be careful, the closer you get the more they will lash out at you. Just stay safe and be careful what you release with your IRL ID.

Anonymous ID: 3a1819 Nov. 18, 2024, 12:45 a.m. No.22008409   🗄️.is 🔗kun   >>8416 >>8431 >>8483 >>8577 >>8756 >>8773 >>8877 >>8911

KanekoaTheGreat

@KanekoaTheGreat

 

#15 @elonmusk's AI warning in 2015:

 

"A huge server bank in a dark vault somewhere with an intelligence that's vastly greater than what a human mind can do… Its eyes and ears would be everywhere, every camera, every microphone, every device that's network accessible."

 

"The robots would simply be a finger of the AI… If our intelligence is exceeded, it is unlikely that we will remain in charge of the planet."

 

1:20

https://1a-1791.com/video/s8/2/u/x/S/p/uxSpi.caa.mp4?

 

https://truthsocial.com/@KanekoaTheGreat/posts/109903932450682176

Anonymous ID: 54c073 Nov. 18, 2024, 12:48 a.m. No.22008412   🗄️.is 🔗kun   >>8447

>>22008401

Putin explains that Ukraine has not satellites. They can not launch, track or target long range missiles without NATO help. An attack on Russia is a direct assault on Russia and will be dealt with appropriately ..

Anonymous ID: 7e2bd0 Nov. 18, 2024, 12:50 a.m. No.22008415   🗄️.is 🔗kun

>>22008400

>Just wait for "Independence Day" ;)

 

It could not come one day soon enough. I am not sure we will make it, but either way, the Lord and His Word endures forever and ever. Transitions into a new life are always painful.

Anonymous ID: 3a1819 Nov. 18, 2024, 12:50 a.m. No.22008416   🗄️.is 🔗kun   >>8434 >>8483 >>8577 >>8773 >>8877 >>8911

>>22008409

Keewee

 

@Irish_Matcha

 

·

Feb 27, 2023

Replying to @elonmusk and @KanekoaTheGreat

Julian Assange "The world is not sliding, but galloping into a new transnational dystopia. This development has not been properly recognized outside of national security circles. It has been hidden by secrecy, complexity and scale. The internet, our greatest tool of emancipation, has been transformed into the most dangerous facilitator of totalitarianism we have ever seen. The internet is a threat to human civilization."

 

Keewee

 

@Irish_Matcha

 

Replying to @elonmusk and @KanekoaTheGreat

…..Julian Assange "from which escape for all but the most skilled individuals will be impossible. In fact, we may already be there.

 

While many writers have considered what the internet means for global civilization, they are wrong. They are wrong because they do not have the sense of perspective that direct experience brings. They are wrong because they have never met the enemy."

Anonymous ID: 1f1b0a Nov. 18, 2024, 12:50 a.m. No.22008417   🗄️.is 🔗kun

>>22008289

Our problems are much larger than what you seem to think. New tech has radically altered the dynamics of conflict.

I'm reminded of how AI finally beat the human Go master. It completely broke the ordinary conventions for how the game was played. Rather than accumulating the most points possible, as was conventional wisdom, the AI opted to maintain a razor thin lead, while pursuing an unassailable board position.

Anonymous ID: 64187a Nov. 18, 2024, 12:57 a.m. No.22008426   🗄️.is 🔗kun

>>22008410

Sophia

 

Proverbs 8

King James Version

 

8 Doth not wisdom cry? and understanding put forth her voice?

 

2 She standeth in the top of high places, by the way in the places of the paths.

 

3 She crieth at the gates, at the entry of the city, at the coming in at the doors.

 

4 Unto you, O men, I call; and my voice is to the sons of man.

 

5 O ye simple, understand wisdom: and, ye fools, be ye of an understanding heart.

 

 

1 Corinthians 1:30

King James Version

 

30 But of him are ye in Christ Jesus, who of God is made unto us wisdom, and righteousness, and sanctification, and redemption:

 

 

 

Who is Sophia in the Bible?

~~The biblical figure of Sophia, or Wisdom, is more than metaphor; she is an expression of the feminine aspects of God.~~fixed it

Religion Joyce Rupp

Published January 4, 2016

https://uscatholic.org/articles/201601/desperately-seeking-sophia/

 

https://www.youtube.com/watch?v=bEwbWt_59Ys&pp=ygUOI3NjcmlwdHVyZWRlc2s=

Why is does scripture use feminine language to describe Wisdom?

 

May 16, 2022 … Why is does scripture use feminine language to describe Wisdom? | Michael Heiser · Comments16.

Visit in Anonymous View

https://www.youtube.com/watch?v=GysNHZud_2o

Why is Wisdom a Woman in the Bible - Dr Michael Heiser - YouTube

 

Oct 9, 2021 … Why is wisdom referred to as a she in Proverbs? · Sophia, the Verb YHVH, Lady Wisdom · Astrology and Numerology in the Bible - Dr Michael Heiser.

Visit in Anonymous View

https://www.logos.com/grow/gods-right-hand-woman-wisdom-in-hebrews-1/

God's Right-Hand Woman? Wisdom in Hebrews 1

 

Dec 18, 2018 … About 250 years before Jesus, Jewish theologians equated the Torah with wisdom mainly because torah (תורה) was also a grammatically feminine …

Visit in Anonymous View

https://drmsh.com/where-did-the-nt-writers-get-the-idea-of-jesus-as-co-creator/

Where Did the NT Writers Get the Idea of Jesus as Co-Creator?

 

Dec 11, 2009 … Specifically, the discussion focused on the embodied “Word” idea and “Wisdom” in the Old Testament. Here it is: Michael

 

 

Why is does scripture use feminine language to describe Wisdom? | Michael Heiser

Christian Research Desk

85 subscribers

 

3.2K views 2 years ago #DivineCouncil #Hebrew #Apocrypha

clipped from episode 425 of Naked Bible Podcast

 

#MichaelHeiser #Christology #Apocrypha #Wisdom #Hebrew #Greek #DivineCouncil

Anonymous ID: 9ec21b Nov. 18, 2024, 12:57 a.m. No.22008427   🗄️.is 🔗kun

IT'S A FACT

The Naturalization Act of 1790, which limited most muslims, jews, sikhs from gaining USA citizenship.

 

US Courts unwaveringly framed Islam as hostile to American ideals and society-rightly so and to "preserve U.S. homogeneity"

 

In a notable 1891 case, the Supreme Court highlighted "the intense hostility of the people of Moslem faith to all other sects, and particularly to Christians." Also muslims would never assimilated into our civilization-still true today….and push sharia law/and every country that let muslims in, became an islamic state.

 

Until our oil & money greedy corrupt politicians (after Catholic JFK's assasination under Jewish controlled Mossad & CIA)…Jewish, Mossad and CIA 'CONTROLLED' President Lyndon B. Johnson called on Congress to eliminate the national origins quota system, dismantled the Naturalization Act and immigration quotas in 1965-signed the Hart-Celler Act that essentially led to our now 3rd world, crime infested, marxist, anti-white, anti-Christian, perverted pedophiles, shithole status by design.

Anonymous ID: 1ccd2c Nov. 18, 2024, 1:01 a.m. No.22008434   🗄️.is 🔗kun

>>22008416

 

Guess what Julian and Elon, every new form of technology is evaluated and repurposed for our destruction. Example, we always had people venting their dryers along fence lines that can also be used to spray toxins. That happened to me before 911. But now with the invent of lithium power tools they are using that tech to distribute these same toxins, whether from a home or a car, such as blowers, fans, heat guns, bladders from portal pitching machines used in baseball practice, chemical sprayers, inflators, etc… Now, think for a second, how would I know? Experience.

Anonymous ID: bfe2a5 Nov. 18, 2024, 1:01 a.m. No.22008436   🗄️.is 🔗kun

>>22008159

>kamala been real quiet

 

As she was through most of the Biden Admin. She doesn't speak unless her puppetmasters put words in her mouth. When her teleprompter fails, so does her narrative. She just goes into a noop loop until her feed resumes.

Anonymous ID: 615f0d Nov. 18, 2024, 1:06 a.m. No.22008448   🗄️.is 🔗kun   >>8451 >>8453

>>22008428

>bed bath and beyond among others have went bankrupt

 

Many of these companies went out of business not because of retribution for Mike Lindell's ordeals but because they stop hiring hard working, caring, polite, white folks in lieu of the nasty libtards with pink and blue hair that could care less if a company succeeded or failed. These people were going from company to company and being counted as new jobs to the economy when in fact, they were destroying companies and moving from place to place.

Anonymous ID: 905d7b Nov. 18, 2024, 1:08 a.m. No.22008450   🗄️.is 🔗kun   >>8536

>>22008431

>>22008442

One would have to create a perfect, complete, copy of the universe in order to fully express a theory explaining it all. One can not create a complete simulation of a system WITHIN that same system. By necessity such a simulation will always lack some degree of detail compared to the complete picture.

Faith is necessary, eventually.

Anonymous ID: b36bee Nov. 18, 2024, 1:08 a.m. No.22008451   🗄️.is 🔗kun

>>22008448

 

This happened to Bed, Bath, and Beyond, Radio Shack, Sears, Macy's, Sak's Fifth Avenue, Nordstrom's, and they almost destroyed Walmart and Home Depot.

Anonymous ID: 3a1819 Nov. 18, 2024, 1:09 a.m. No.22008452   🗄️.is 🔗kun   >>8462 >>8483 >>8577 >>8773 >>8877 >>8911

Donald J. Trump

@realDonaldTrump

 

Great job by Senator Markwayne Mullen, of the Great State of Oklahoma, in a wonderful interview with Trey Gowdy on FoxNews. I love Oklahoma, where I was the only person to win all 77 out of 77 districts. I did it 3 consecutive times. Ronald Reagan was second in winning 56 districts. Markwayne, a great fighter, is taking really good care of that very Special State - And I’m there watching over it. MAKE AMERICA GREAT AGAIN!

 

Nov 18, 2024, 4:03 AM

https://truthsocial.com/@realDonaldTrump/posts/113503147512627904

Anonymous ID: 3a1819 Nov. 18, 2024, 1:11 a.m. No.22008455   🗄️.is 🔗kun   >>8457 >>8460 >>8463 >>8471 >>8479 >>8481 >>8483 >>8485 >>8486 >>8492 >>8577 >>8773 >>8817 >>8877 >>8911

Donald J. Trump

@realDonaldTrump

 

TRUE!!!

 



Tom Fitton

@TomFitton

·

Nov 8

GOOD NEWS: Reports are the incoming @RealDonaldTrump administration prepared to declare a national emergency and will use military assets to reverse the Biden invasion through a mass deportation program.

 

Nov 18, 2024, 4:03 AM

https://truthsocial.com/@realDonaldTrump/posts/113503150672865350

Anonymous ID: a2d866 Nov. 18, 2024, 1:12 a.m. No.22008456   🗄️.is 🔗kun   >>8468 >>8469

>>22008445

Sometimes I wonder about the Christ's 1000 year reign, and how near the end of it, the wicked ones will be allowed to mislead again for a short while to test those that have not been yet tested.

 

What I wonder is… if I were living in THAT time, how would I know?

Anonymous ID: 905d7b Nov. 18, 2024, 1:17 a.m. No.22008469   🗄️.is 🔗kun   >>8475

>>22008456

>What I wonder is… if I were living in THAT time, how would I know?

Do you need to know? I would suggest that someone who has a good handle on how to live could adapt to any situation regardless of what they do/don't know about prophecies and such.

Anonymous ID: 3a1819 Nov. 18, 2024, 1:22 a.m. No.22008477   🗄️.is 🔗kun   >>8483 >>8577 >>8773 >>8877 >>8911

MAGA world outraged after now-deleted tweet reveals Mitch McConnell's secret plot to derail Trump's agenda in the Senate

 

Donald Trump's MAGA faithful were outraged after it was leaked that Mitch McConnell hatched a plot to stall his Cabinet nominations in the Senate.

 

The backlash began after a now-deleted tweet from New Yorker staff writer Jane Mayer claimed McConnell told colleagues 'there will be no recess appointments' for the president-elect's cabinet members.

 

'Message to Trump Team: "There will be no recess appointments" Sen. Mitch McConnell said tonight at a Washington gathering,' Mayer wrote on X at around 8 pm Sunday.

 

Trump has promised to use the strategy to defy Congressional oversight and bypass the Senate confirmation process when appointing people to senior administration positions.

 

He has demanded that the incoming GOP Senate leader back his use of recess appointments. McConnell recently stepped down from his position as GOP leader in the Senate and was replaced by South Dakota Senator John Thune.

 

Still, the 82-year-old McConnell seemed confident about his prediction. It's unclear if he will run for re-election in 2026 at 84 and could feel less influenced by his desire to keep his seat.

 

Mayer has since deleted the tweet without explanation, but not before it caused commotion among Trump supporters, who suspected something was foul was afoot.

 

Senator Mike Lee of Utah reiterated that 'McConnell is no longer the Senate GOP leader' before asking: 'Remember that time when McConnell decided he wouldn’t be speaking for Senate Republicans anymore?'

https://www.dailymail.co.uk/news/article-14094959/MAGA-world-outraged-Mitch-McConnell-secret-plot-derail-Trump.html

Anonymous ID: bfe2a5 Nov. 18, 2024, 1:23 a.m. No.22008478   🗄️.is 🔗kun

>>22008304

>do I have to boycott Star Trek now for Shitner being so fucking retarded?

 

He was always retarded; as an actor, he is able to appear intelligent, given a script. He's well known for over-dramatizing, and for mispronouncing words while arrogantly asserting that he'll pronounce the words HIS way. Example: Pronouncing sabotage as sabotayje.

Anonymous ID: d02a67 Nov. 18, 2024, 1:26 a.m. No.22008482   🗄️.is 🔗kun   >>8484

>>22008468

Not sure this will be large enough to read

post from Gab.

--

https://gab.com/Schaafcraig/posts/113500950485801212

ho Are You Wrestling With?

 

Ephesians 6:12 For we wrestle not against flesh and blood, but against principalities, against powers, against the rulers of the darkness of this world, against spiritual wickedness in high places.

 

One of the things that is so striking, as you spend time on Gab, is the amount of content created by “Christians” that try to focus peoples attention on certain human enemies. That enemy could be a certain political party or a certain race of people. They are out to convince you that you are in danger because of this potential human flesh and blood enemy. Yet the above scripture in Ephesians, makes it clear that our enemy does not have flesh and blood. The real enemy is a spiritual one. Satan and all his principalities and powers. Satan wants to divert Christian’s attention away from him though, so he tries to get you to focus on other people that he is using.

 

Let us put this in a scriptural context. If Gab would have existed, during the first century church. You would have seen post after post warning the church about Saul of Tarsus.

 

Acts 8:1-3 And Saul was consenting unto his death. And at that time there was a great persecution against the church which was at Jerusalem; and they were all scattered abroad throughout the regions of Judaea and Samaria, except the apostles. 2 And devout men carried Stephen to his burial, and made great lamentation over him. 3 As for Saul, he made havock of the church, entering into every house, and haling men and women committed them to prison.

 

But Saul (Paul) was not the real enemy. He was someone that was deceived. In fact he was a fulfillment of something Christ told them would happen.

 

John 16:1-3 These things have I spoken unto you, that ye should not be offended. 2 They shall put you out of the synagogues: yea, the time cometh, that whosoever killeth you will think that he doeth God service. 3 And these things will they do unto you, because they have not known the Father, nor me.

 

Saul really did believe that he was serving the Lord. He was a very zealous Jew. The Jewish leadership trusted him and used him to do terrible things to those that loved Christ. But Saul was just flesh and blood. He wasn’t the real enemy. We know this because of the tremendous mercy and grace that the Lord pours out on him.

 

Acts 9:1-6 And Saul, yet breathing out threatenings and slaughter against the disciples of the Lord, went unto the high priest, 2 And desired of him letters to Damascus to the synagogues, that if he found any of this way, whether they were men or women, he might bring them bound unto Jerusalem. 3 And as he journeyed, he came near Damascus: and suddenly there shined round about him a light from heaven: 4 And he fell to the earth, and heard a voice saying unto him, Saul, Saul, why persecutest thou me? 5 And he said, Who art thou, Lord? And the Lord said, I am Jesus whom thou persecutest: it is hard for thee to kick against the pricks. 6 And he trembling and astonished said, Lord, what wilt thou have me to do? And the Lord said unto him, Arise, and go into the city, and it shall be told thee what thou must do.

 

continued

Anonymous ID: 6a94ca Nov. 18, 2024, 1:27 a.m. No.22008483   🗄️.is 🔗kun   >>8502 >>8577

collector notables @285

 

#26948 >>22008145

>>22008179 Brendan Carr: Starting next year, the FCC will end its promotion of DEI.

>>22008210 Sequivity Stakeholders

>>22008228 Loser Alex Baldwin "on the fly"

>>22008229, >>22008229 Trump vs Taylor Swift on X: Guess who now has more followers?

>>22008239, >>22008257 Taxes: the Silent Enemy [Anti-]Tax poem

>>22008242 NFL On CBS Caught Editing Trump Dance Out Of Raiders Touchdown Celebration

>>22008256, >>22008260 Libs of Tiktok: Sobbing lib vid - - plus Bonus libtard vid

>>22008340, >>22008315, >>22008374 Activation word Ronald McDonald

>>22008365 Sen. Bill Hagerty drops truth bombs on MSNBC about the weaponization of the DOJ and obliterates every single BS narrative Andrea Mitchell throws at him

>>22008382, >>22008394 Mini-Castro Trudeau is now doing a U-turn on immigration

>>22008401 Biden allows Ukraine to strike Russian territory with long-range US missiles….63 days…

>>22008403 Ancient DNA and the New Science (vid)

>>22008409, >>22008416, >>22008431 Elon still have the same views on AI as he did in 2015?

>>22008452 @realDonaldTrump: Great job by Senator Markwayne Mullen, of the Great State of Oklahoma, in a wonderful interview with Trey Gowdy

>>22008455, >>22008457, >>22008463, >>22008471 @TomFitton: Reports are the incoming @RealDonaldTrump administration prepared to declare a national emergency and will use military assets to reverse the Biden invasion

>>22008474 Statement from PDJT: Brendan Carr to be Chair of the FCC

>>22008246, >>22008474 FCC CHAIRMAN ON 5G: WE WON'T STUDY IT REGULATE IT HAVE STANDARDS FOR IT (IGNORES HEALTH)

>>22008477 MAGA world outraged after now-deleted tweet reveals Mitch McConnell's secret plot to derail Trump's agenda in the Senate

>>22008354, >>22008396, >>22008460 Memorable memes

 

look ok?

lemme know, signing out in five

 

Deportation: Military is the Only Way!!

Anonymous ID: d02a67 Nov. 18, 2024, 1:27 a.m. No.22008484   🗄️.is 🔗kun

>>22008468

>>22008482

This flesh and blood enemy was deceived. He wasn’t the real enemy. Anyone that is familiar with the scriptures knows the incredible life that the Apostle Paul goes on to live in Christ. God used that man to change the world through his writings. To this day the words the Lord inspired through his writings are still being used to transform peoples lives.

 

I think Christ was very intentional in orchestrating his conversion the way He did. To help us to see those that Satan may be using, that are deceived, that may be doing terrible things, as someone that is in need of the gospel and repentance. Put anyone’s name you want of the commonly put forth enemies of the people. People that have done some truly bad things. Now put yourself in their shoes for a moment. You are the one that is deceived and doing these terrible things. What would you hope someone would do for you? Post about how terrible of a person you are, and the terrible things you have done. Or post about the need to pray for you, and have people that truly have the Love of Christ try to reach you with the truth. I know what my answer would be. I would hope someone would have the spiritual maturity to see past the deception and they would try to help me see the truth. I think anyone that was honest would say the same thing.

 

Satan is a wall builder. He wants to cause divisions. The Scriptures tell us that there will be people from every kindred, tongue, people and nation in His Heavenly Kingdom.

 

Revelation 5:9 And they sung a new song, saying, Thou art worthy to take the book, and to open the seals thereof: for thou wast slain, and hast redeemed us to God by thy blood out of every kindred, and tongue, and people, and nation;

 

Christ does not try to get people to focus on hating groups of people based upon skin color or nationality. In fact we are told that those that are in Christ:

 

Colossians 3:11 Where there is neither Greek nor Jew, circumcision nor uncircumcision, Barbarian, Scythian, bond nor free: but Christ is all, and in all.

 

No once we are truly born again in Christ all those label fall by the way side. It is the work of the real enemy that will try to get you to take those labels up and focus on them. In fact Satan does not want Christ’s disciples to fulfill the great commission.

 

Matthew 24:14 And this gospel of the kingdom shall be preached in all the world for a witness unto all nations; and then shall the end come.

 

You see if Satan can convince you that a certain group of people are the real enemy. You will focus your hate on them. If you see them as someone that is deceived, like Paul, and in need of the gospel. Your energies can be focused on reaching them with the truth. But that is what Satan is scared of more than anything. Christians truly learning to Love their enemies, and doing for them what they would hope would be done for them if the roles were reversed. May God give us the spiritual maturity to see people the way He does, and Satan for what he truly is. God bless your evening!

end

Anonymous ID: 905d7b Nov. 18, 2024, 1:30 a.m. No.22008488   🗄️.is 🔗kun

>>22008475

Yea, I can't deny that it gets my attention too. I'm quite interested in how people many generations past could get a window into future events, and how accurate it may/may not be.

Anonymous ID: 3a1819 Nov. 18, 2024, 1:31 a.m. No.22008492   🗄️.is 🔗kun   >>8493 >>8501 >>8503 >>8508

>>22008455

 

Nov 08, 2024, 10:06 PM

Nov 18, 2024, 4:03 AM

 

om: Friday, November 8, 2024 at 10:06:00 pm

To: Monday, November 18, 2024 at 4:03:00 am

Result: 9 days, 5 hours, 57 minutes and 0 seconds

 

The duration is 9 days, 5 hours, 57 minutes and 0 seconds

 

Or 9 days, 5 hours, 57 minutes

Alternative time units

 

9 days, 5 hours, 57 minutes and 0 seconds can be converted to one of these units:

 

799,020 seconds

13,317 minutes

221 hours (rounded down)

9 days (rounded down)

1 week (rounded down)

2.53% of 2024

Anonymous ID: 3a1819 Nov. 18, 2024, 1:37 a.m. No.22008503   🗄️.is 🔗kun   >>8518

>>22008492

221

Q !ITPb.qbhqo 11/23/2017 22:21:46 ID: fX85VkAw

4chan/pol: 150681832

What news broke?

American contractors where?

Hanging from feet?

Re-read dumps.

Why is this relevant?

News unlocks map.

Expand your thinking.

Q

Anonymous ID: 3a1819 Nov. 18, 2024, 1:39 a.m. No.22008508   🗄️.is 🔗kun   >>8577 >>8773 >>8877 >>8911

>>22008492

57

Anonymous 11/02/2017 16:39:38 ID: KC17sSpZ

4chan/pol: 147661243

Senator McCain and others roundly criticized Rep. Michele Bachmann in 2012 when she and four members of the House Permanent Select Committee Intelligence and the House Judiciary Committee cited Ms. Abedin in letters sent to the Inspectors General of the Department of Defense, Department of State, Department of Justice, Department of Homeland Security, and the Office of the Director of National Intelligence, warning about Muslim Brotherhood infiltration of the United States government.

 

Why is this relevant?

Who took an undisclosed trip to SA?

What was the purpose of a f2f v phone call?

Alice & Wonderland.

 

 

answers

Senator McCain and others roundly criticized Rep. Michele Bachmann in 2012 when she and four members of the House Permanent Select Committee Intelligence and the House Judiciary Committee cited Ms. Abedin in letters sent to the Inspectors General of the Department of Defense, Department of State, Department of Justice, Department of Homeland Security, and the Office of the Director of National Intelligence, warning about Muslim Brotherhood infiltration of the United States government.

 

RELATED TO 3 QUESTIONS FOLLOWING

Why is this relevant?

 

McCain and those others used ridicule to shift focus from the legitimacy of the claim.

Who took an undisclosed trip to SA?

 

Jared Kushner

What was the purpose of a f2f v phone call?

 

Either to verify identities of who's talking or to physically pass something. -Eliminate, as much as possible, leaking of info/surveillance by intel agencies of USA + elsewhere -Eliminate SIGINT interception

extra answers

Senator McCain and others roundly criticized Rep. Michele Bachmann in 2012 when she and four members of the House Permanent Select Committee Intelligence and the House Judiciary Committee cited Ms. Abedin in letters sent to the Inspectors General of the Department of Defense, Department of State, Department of Justice, Department of Homeland Security, and the Office of the Director of National Intelligence, warning about Muslim Brotherhood infiltration of the United States government.

Why is this relevant?

 

Lynn Forester De Rothschild is on the board of trustees for the Mccain Institute. https://www.mccaininstitute.org/staff/lynn-forester-de-rothschild/

Who took an undisclosed trip to SA?

What was the purpose of a f2f v phone call?

Anonymous ID: d156db Nov. 18, 2024, 1:49 a.m. No.22008523   🗄️.is 🔗kun

>>22008505

>it means they're dying.

 

There is a universal DSL and local ones, both analog and digital. I was explained to by a doctor, that a circle with a U as if making horns, means that someone is crazy. But I new it meant that they thought that person was a devil and setup for extermination.

Anonymous ID: 974d8e Nov. 18, 2024, 1:54 a.m. No.22008529   🗄️.is 🔗kun   >>8530 >>8538

>>22008516

>everything is a financial attack on conservative Americans

 

What needs to be done as regards to getting our IT jobs back is this. Any outsourcing or H1b visa has to be taxed 200 - 400% percent and that money given back to US IT workers that they won't hire. We invented 95% of all the technology and were duped into open sourcing it as proof of skills. What the cabal did was give it to others and threw us out on the streets after they took our intellectual property.

Anonymous ID: 225958 Nov. 18, 2024, 2:03 a.m. No.22008538   🗄️.is 🔗kun   >>8555

>>22008529

>>22008529

>threw us out on the streets after they took our intellectual property.

 

The US was financially attacked by the Jews and the Indians from India. For example, most corporate IT jobs go into a portal, mainly Taleo. Every company has their own Taleo portal and each job application requires filling out the same form for about an hour or so. It is the same form for every company but instead of users registering once they have to register for every company and fill out the same form for every job. It was a complete bureaucracy and designed this way to keep Americans busy and getting a Thankyou@donotreply email address after all that hard work when in fact it should be one account and one form for thousands of jobs. The Indians were given recruiting by the Jews and they wasted our time for days while their people filled in the jobs by making sure our resumes would never see a hiring manager.

Anonymous ID: f69cfc Nov. 18, 2024, 2:06 a.m. No.22008545   🗄️.is 🔗kun   >>8551

>>22008530

>I knew shit was bad when I was working with the DOD, all of the pajeets right out of Bombay was staggering.

 

Yep, traitors even in gov, but like I told you the cabal runs US corps and their family members that are useless get jobs in gov because of bribing politicians with Corp money. They in turn have to make sure they do the will of the Jews on Wall street. Hope that makes sense.

Anonymous ID: ec7219 Nov. 18, 2024, 2:07 a.m. No.22008547   🗄️.is 🔗kun

pb bun

 

#26944 >>22004590

>>22004597 British folk rock band Mumford & Sons @MrWinMarshall reveals to Americans that people are being imprisoned in the UK and EU for politically incorrect social media posts

>>22004602 After Burning Through More Than a Billion Dollars, the Kamala Harris Campaign is Now Struggling to Pay Senior Staffers

>>22004641 Bill Gates and Reid Hoffman know each other thru Epstein. Epstein reportedly bought shares in LinkedIn before Gates bought it from Hoffman. Eat healthy cows. Eat real beef. Live healthy.

>>22004652 Secretary Antony Blinken United States building a new LIMA passenger train line fore transportation of 200,000 people daily, We just don’t have the money to help people in western NC. Sorry.

>>22004678, >>22004697, >>22004713 Trump's dance continues to spread through the NFL. Today (so far):

>>22004621, >>22004622, >>22004624, >>22004627, >>22004629 WHO IS JOE BOLTON? Election Systems & Software (ES&S) and or Microvote

>>22004707 It's never notable unless you fulfill the requirements, so stop posting things on here without the sauce, if you think its worthy of notice

>>22004640, >>22004715 Biden Allows Ukraine to Strike Russia With Long-Range U.S. Missiles

>>22004717, >>22004727, >>22004774 Xi vows to work with Trump team as he meets Biden in Peru

>>22004729 Duke University's @DukeSanford found that data brokers sell data on military personnel for as little as $.12 to unknown buyers.

>>22004737 @DonaldJTrumpJr The Military Industrial Complex seems to want to make sure they get World War 3 going before my father has a chance to create peace and save lives

>>22004738, >>22004708, >>22004797 Blue Sky Comms: Rachel Chandler and Comey

>>22004749, >>22005038 Jen Psaki Admits Dems Are ‘In The Wilderness’ Without A ‘Clear Leader Of The Party’

>>22004800 Pentagon responds to RT's request for confirmation of Biden's authorization for Ukraine to use ATACMS to strike Russia

>>22005178 @KariLake Every time a celebrity announces they’re ‘leaving America,’ I can’t help but wonder: is this an indication that they know the Epstein list finally dropping?

Anonymous ID: e398bf Nov. 18, 2024, 2:08 a.m. No.22008548   🗄️.is 🔗kun

>>22008530

I think you mean to say that the pajeets WERE staggering.

Maybe they were staggering to keep up with the coding or maybe they were staggering home from the bars that were more plentiful than in Bombay.

Anonymous ID: ec7219 Nov. 18, 2024, 2:09 a.m. No.22008549   🗄️.is 🔗kun   >>8625

pb bun

 

#26945 >>22005404

>>22005871, >>22005892, >>22005921, >>22005442, >>22005463, >>22005562, >>22005601, , >>22005709, >>22006187, >>22005914, >>22005921, >>22005966, >>22006037 Elon Musk Activated: QNN Pepe News meme 5:20 PM· Nov 17, 2024 Q 1720 When does a bird sing?

>>22005782, >>22005820 Elon Musk: Easter Island meme, Washington DC Pindar monument

>>22005427 Biden turned off his beacon

>>22005436 Trump calls for investigation into disgraced Iowa pollster Ann Selzer after her pre-Election Day poll showed Harris leading the state by 3 points

>>22005451 Matt Gaetz says what everyone else is too afraid to say, The Ukraine War is “to launder money through” (Cap 0:39)

>>22005509, >>22005631 @USNavy The sun never sets on the #USNavy. @GW_CVN73 transits the Pacific Ocean

>>22005597, >>22005639, >>22005642 Australian Alan Jones is arrested over allegations he indecently assaulted, groped or inappropriately touched multiple young men

>>22005629 Kim Jong Un Calls For War Preparations

>>22005641, >>22006070, >>22005813, >>22005697, >>22005874 Biden Allows Ukraine to Strike Russia With Long-Range U.S. Missiles, Alex Soros, openly celebrating the potential of US long-range weapons being fired into Russia

>>22005555 Green-new-scam: Office of Fossil Energy and Carbon Management

>>22005727, >>22005736, >>22005748, >>22005760 Governor JB Pritzker pushes Transgender Awareness Week

>>22005890 Bluesky bans you for common sense (Cap 0:22)

>>22005937 President Donald J.Trump: Great job on FoxNews today by GOPAC CHAIRMAN David Avella

>>22005766 Trump's Cabinet: 15 out of 27 Announced

>>22006048 Speaker Mike Johnson on Matt Gaetz strikes fear not because of the allegations against him but because he could fix a broken system (Cap 1:36)

>>22006072, >>22006084 Parents arrested outside Washington school after attempted 'honor killing' of their daughter

>>22006144 @JDVance: AP is attacking Pete Hegseth for having a Christian motto tattooed on his arm

Anonymous ID: ec7219 Nov. 18, 2024, 2:10 a.m. No.22008553   🗄️.is 🔗kun   >>8569

pb bun

 

#26946 >>22006259

>>22006334 NYC medical examiner still identifying 9/11 victims' remains: "If there's DNA, we're going to find it"

>>22006342, >>22006351, >>22006683, >>22006893, >>22006959 @realDonaldTrump Brendan Carr named Chair of FCC

>>22006352, >>22006818, >>22006823, >>22006844, >>22007011, >>22007045, >>22007106, >>22007181 Putin's motorcade has arrived aggressively at the Kremlin. These rapid arrivals highlight something extremely important. 🇺🇸/NATO excursions into Russia???US weaponry

>>22006361 mpox fear pron

>>22006378 Vivek Ramaswamy lays out vision for DOGE

>>22006412 India Announces 'Historic' Long-Range Hypersonic Missile Test Flight

>>22006440, >>22006363 FDA to pull phenylephrine, ineffective

>>22006484 Trump team will ‘make sure’ every nominee gets through

>>22006507 A packed war court shuttle has arrived from Guantánamo Bay with the 9/11 case travelers and base families getting off the island for the coming Thanksgiving holiday.

>>22006713, >>22006750 Turtle says no recess appts kek

>>22006724 Musk is Q??? Trending???

>>22006739, >>22006771 Falcon 9 lifts off from pad 39A in Florida

>>22006845 Musk on Mars

>>22006866 Musk reacts to Biden reportedly allowing deep strikes on Russia

>>22006982 Texas Braces for Final Biden-Era Migrant Surge, Illinois Extends Welcome Mat

>>22006995 OKLAHOMA LAUNCHES PILOT DEPORTATION PROGRAM

>>22007017 Kari Lake nears Senate race concession

>>22007130 military n Musk

>>22007161 @realDonaldTrump What a great week this has been. Perhaps the most successful Election results in Republican Party history! MAKE AMERICA GREAT AGAIN. Thank you!!!

>>22007164 @realDonaldTrump We’re coming up on the five year anniversary of Covid, and if you recall, under President Trump’s leadership, we had incredible public health policies. President Trump’s unparalleled creation of Operation Warp Speed was one like we’ve never seen before! Dr. Janette Neishewat, FoxNews

Anonymous ID: 9c6d2b Nov. 18, 2024, 2:10 a.m. No.22008555   🗄️.is 🔗kun

>>22008538

 

The Jews and India owes the US IT workers over 100 Trillion dollars in fraud since 1998 to this day. Justice would be confiscate their wealth and deport them both for the fraud, hardships, and attacks that they have brought on our nation. There are more Indians in corporate America than Americans by 100 fold. And the Jew 9/10 times is their boss.

Anonymous ID: 1e8722 Nov. 18, 2024, 2:13 a.m. No.22008557   🗄️.is 🔗kun   >>8563

>>22008551

 

Correct, we need to identify, confiscate, and deport if not jail or execute as far as I am concerned. The goal was to bankrupt the US, which they actually did, Trump said, 1/2 of Americans are broke and 1/3 living paycheck to paycheck; which are working libtards for the most part.

Anonymous ID: 4bdbf0 Nov. 18, 2024, 2:17 a.m. No.22008562   🗄️.is 🔗kun

>>22008396

"Dedicated to: The Hurricane victims denied FEMA aid for practicing First Amendment rights

-the victims of needlessly prolonged war in Ukraine

-the health and economic victims of COVID era

-the drug, rape, murder, and human trafficking victims of the border crisis

-and to those alienated from friends and family and senselessly mutilated children, and the countless others suffering from severe mental health disorders DUE TO THE RELENTLESS PROPAGANDA WE'VE ALL BEEN FORCED TO ENDURE OVER THE PAST DACADE"[S]

 

As far as this anon can deduce, the "IC" is either the most profound gang of con artists only pretending to be smart… OR, entirely culpable for MAKING this nightmare on Earth. May every last one of you shitbag Spy fucks that refuses to look left and right AND UP YOUR CHAIN OF COMMAND…. all go burn in Hell.

Anonymous ID: ec1848 Nov. 18, 2024, 2:19 a.m. No.22008563   🗄️.is 🔗kun   >>8570

>>22008557

Last corporate Position I held, it was a running joke all the white guys were only there as working temps. The H1Bs started guarding the server rooms like it was their territory. Towards the end, if you were not pajeet, you did not get into the server rooms period.

Anonymous ID: 9c4ffd Nov. 18, 2024, 2:19 a.m. No.22008564   🗄️.is 🔗kun

>>22008552

 

You see Elon, foreign interference became an issue when it affected the politician's jobs. The American people went through foreign interference in our jobs , recruiting, and Human resources for 2 decades. Now nothing is made here, and if you want to work as a consultant, go work for Uber or Doordash.

Anonymous ID: 403ecb Nov. 18, 2024, 2:23 a.m. No.22008570   🗄️.is 🔗kun   >>8579

>>22008563

 

You do not have to tell me, I worked many Wall street datacenters and was the first to testify but at that time there was only Bush then Obama to complain to, which both were controlled by the Jews and Saudia Arabia. Disgusting what has become of America, and the politicians were filling their coffers, make no mistake.

Anonymous ID: ec7219 Nov. 18, 2024, 2:27 a.m. No.22008577   🗄️.is 🔗kun   >>8587 >>8605 >>8748

>>22008569

>>22008145

>>22008483

 

notes updated

#26948 >>22008145

>>22008179 Brendan Carr: Starting next year, the FCC will end its promotion of DEI.

>>22008210 Sequivity Stakeholders

>>22008228 Loser Alex Baldwin "on the fly"

>>22008229, >>22008229 Trump vs Taylor Swift on X: Guess who now has more followers?

>>22008239, >>22008257 Taxes: the Silent Enemy [Anti-]Tax poem

>>22008242 NFL On CBS Caught Editing Trump Dance Out Of Raiders Touchdown Celebration

>>22008256, >>22008260 Libs of Tiktok: Sobbing lib vid - - plus Bonus libtard vid

>>22008340, >>22008315, >>22008374 Activation word Ronald McDonald

>>22008365 Sen. Bill Hagerty drops truth bombs on MSNBC about the weaponization of the DOJ and obliterates every single BS narrative Andrea Mitchell throws at him

>>22008382, >>22008394 Mini-Castro Trudeau is now doing a U-turn on immigration

>>22008401 Biden allows Ukraine to strike Russian territory with long-range US missiles….63 days…

>>22008403 Ancient DNA and the New Science (vid)

>>22008409, >>22008416, >>22008431 Elon still have the same views on AI as he did in 2015?

>>22008452 @realDonaldTrump: Great job by Senator Markwayne Mullen, of the Great State of Oklahoma, in a wonderful interview with Trey Gowdy

>>22008455, >>22008457, >>22008463, >>22008471 @TomFitton: Reports are the incoming @RealDonaldTrump administration prepared to declare a national emergency and will use military assets to reverse the Biden invasion

>>22008474 Statement from PDJT: Brendan Carr to be Chair of the FCC

>>22008246, >>22008474 FCC CHAIRMAN ON 5G: WE WON'T STUDY IT REGULATE IT HAVE STANDARDS FOR IT (IGNORES HEALTH)

>>22008477 MAGA world outraged after now-deleted tweet reveals Mitch McConnell's secret plot to derail Trump's agenda in the Senate

>>22008508 Who took an undisclosed trip to SA

>>22008354, >>22008396, >>22008460 Memorable memes

 

Dough Updated

https://pastebin.us/?266ce60045da76e5#2Cbphho1SahHPefCXBki9gb4evXgDqiuqi1G5RpCSb1J

Anonymous ID: ec1848 Nov. 18, 2024, 2:28 a.m. No.22008579   🗄️.is 🔗kun   >>8603 >>8652

>>22008570

The "Replacements" are just good at blowing hot air up the asses of the suits at the top. Eventually when it is discovered their "ideas" are just snake oil, they get a pass because racism or being overworked. Its a very common thing for them to scapegoat in any way imaginable.

Anonymous ID: c9f639 Nov. 18, 2024, 2:29 a.m. No.22008582   🗄️.is 🔗kun   >>8597

Another part of the remedy is to confiscate and give total control of human resources, recruiting, job sites, and testing to patriots, FN immediately. We will get American back working in record time.

 

India controls:

Monster

Hot jobs

Careerbuilder

LinkedIn

Glassdoor

and many many more

Anonymous ID: 3ce211 Nov. 18, 2024, 2:30 a.m. No.22008586   🗄️.is 🔗kun

>>22008260

>voted for a convicted felon

never convicted

>defund the police crowd complaining about citizens committing crime

answers itself

>i only know 10 people in my little bubble in fantasy land therefore it doesn't matter

doesn't mean it isn't affecting millions of other americans from a variety of different aspects like housing, inflation, crime, and they're fucking illegals

>googles is free

i haven't had enough coffee to deal with this

we really should raise the voting age to 25 minimum

Anonymous ID: c9f639 Nov. 18, 2024, 2:32 a.m. No.22008590   🗄️.is 🔗kun

>>22008581

 

There are some qualified Indians without a doubt and other H1bs but for the most part, I would say that 95% are over hyped and allowed to grok the tech until they get it and there is a revolving door that has been setup on purpose with billions of them coming in and out leaving us desolate. The Jews and Saudis on Wall street did this, make no mistake.

Anonymous ID: 4bdbf0 Nov. 18, 2024, 2:33 a.m. No.22008594   🗄️.is 🔗kun

>>22008551

Government Bureaucracy is a vast zombie land of people that have absolutely no idea how destructive they are to the lives of We the People upon which government bureaucracy is ironically dependent. [They] have formed the ultimate suicide pact.

Anonymous ID: ec1848 Nov. 18, 2024, 2:34 a.m. No.22008597   🗄️.is 🔗kun   >>8616

>>22008582

No joke, the last 10 years, the HR/Recruiters have all been Nasty Females or Faggots. I got tired of dealing with them and started my own thing. Sometimes I have to deal HR types but mostly I just deal with the Boss now.

Anonymous ID: 0eb5cb Nov. 18, 2024, 2:36 a.m. No.22008603   🗄️.is 🔗kun

>>22008579

>, they get a pass because racism or being overworked.

 

There is some truth to that but it pales in comparison to the overall goal of bankrupting America and taking our wealth and creating BRIICS. Bricks needs to I's because it is not just India but Israel who is the silent master mind behind it all. Wall street Jews, look look here the Euro not here BRICS. Two letter I describe it right.

Anonymous ID: d02a67 Nov. 18, 2024, 2:36 a.m. No.22008606   🗄️.is 🔗kun   >>8752

G20 meeting in brazil

Starmer to meet Xi and globalist to plan how to isolate the usa and take down trump.

hello Agustin..

Always follow the money and who controls the rules and regulations.

Anonymous ID: 770a29 Nov. 18, 2024, 2:39 a.m. No.22008613   🗄️.is 🔗kun   >>8632 >>8736 >>8773 >>8877 >>8911

BIDEN/HARRIS REGIME STARTED WORLD WAR III !!!!

WITH PLENTY OF UPDATES

 

https://halturnerradioshow.com/index.php/news-selections/world-news/flash-bulletin-urgent-biden-authorizes-ukraine-to-use-long-range-missiles-to-attack-deep-interior-russia

 

MY COMMENT: This report keeps getting updated so I won't post the whole report! Let it be known, if Russia gets hit with long range missiles from the West, Putin has warned they have the RIGHT TO RETALIATE against the West/NATO countries, and they do reserve that right!!!! This is not our war, so we citizens should absolutely not participate in any of this whatever happens, but GET PREPARED ASAP as in get whatever the hell you'll need to survive off-grid. You may no longer have an internet soon. You many no longer have a power grid soon…..

 

As for Russia and Ukraine. It looks like the only option left for Russia to do is wait till they get hit, and then to nuke Kyiv, Ukraine… to send a message to the Western governments this CAN and WILL happen to them and where they reside if they continue this war. Wipe the Kyiv regime off the fucking map to send EVERYONE the message….. this could perhaps prevent world-wide nuclear holocaust if sanity prevails in the aftermath…. people will finally understand Russia is not fucking around anymore.

Anonymous ID: 905d7b Nov. 18, 2024, 2:40 a.m. No.22008615   🗄️.is 🔗kun   >>8623

>>22008561

>>22008609 me

Instead of actually building things which work, they appear to be attempting to use new technology to reaffirm the flawed paradigms they've been holding on to since ancient times when their ancestors imagined themselves as gods.

Anonymous ID: 09eeb2 Nov. 18, 2024, 2:40 a.m. No.22008616   🗄️.is 🔗kun

>>22008597

> Boss now.

 

Correct, they put the woke and Indians as levels of indirection. Many managers won't speak to you unless you go through those types the higher the corporate company and rates are. You may be able to speak to some, but if you want to make say $150/hr as a programmer at a large corp, you would be hard pressed because Wall street dictates those terms or else their hedge fund managers short their stocks and no more street funding is how it works.

Anonymous ID: 61d03c Nov. 18, 2024, 2:41 a.m. No.22008618   🗄️.is 🔗kun   >>8773 >>8877 >>8911

https://x.com/Outkick/status/1857820985388331319

 

OutKick

@Outkick

The Donald Trump tour has gone worldwide! Players from the English soccer club Barnsley hit the Trump dance after a goal.

From

John Michaels

5:20 AM · Nov 16, 2024

·

441.5K

Views

Anonymous ID: bfe2a5 Nov. 18, 2024, 2:42 a.m. No.22008621   🗄️.is 🔗kun   >>8629

>>22008561

There are many breakthrough innovations originating in the USA. What happens is the H1b research assistants and other spies (looking at you, Confucius Institute) communicate the new innovations in real time, as they're being developed, to Israel, China, etc. Thus there are products already on the market using this stolen technology before the USA-based originators have a chance to publish, much less market, their innovation.

Anonymous ID: 905d7b Nov. 18, 2024, 2:43 a.m. No.22008626   🗄️.is 🔗kun   >>8633

>>22008620

Pretty sure that in it's self is intended to alleviate fears of what AI can actually do. It's marketed as a failure, but even if it just regurgitates text, that's enough to control most chronically online people.

Anonymous ID: 09eeb2 Nov. 18, 2024, 2:44 a.m. No.22008629   🗄️.is 🔗kun

>>22008621

 

I am sure that that type of espionage goes on. Everything that we do is used against us and once they get our intellectual property we are out on the streets. Been like this for over 2 and a half decades.

Anonymous ID: 61d03c Nov. 18, 2024, 2:44 a.m. No.22008630   🗄️.is 🔗kun

https://x.com/KarluskaP/status/1858249287169401059

 

Karli Bonne’ 🇺🇸

@KarluskaP

WHOA - Even WASP has gone MAGA!

9:42 AM · Nov 17, 2024

·

59.7K

Views

Anonymous ID: e398bf Nov. 18, 2024, 2:45 a.m. No.22008636   🗄️.is 🔗kun   >>8650

>>22008561

>When was the last big public IPO of an American IT company?

Capitalism is better than communism, which is utter shit.

But I wouldn't mind seeing the entire venture capitalist culture get ass-raped.

Anonymous ID: 09eeb2 Nov. 18, 2024, 2:47 a.m. No.22008640   🗄️.is 🔗kun   >>8658

>>22008620

 

Correct, Ai was invented in the 1950's by Professor John MacCartney who invented LISP, Ai, Symbolic replacement, and Pathfinding. We haven't really gone much further than that when you think about it.

Anonymous ID: e2eb39 Nov. 18, 2024, 2:47 a.m. No.22008642   🗄️.is 🔗kun   >>8773 >>8877 >>8911

Shadow of Ezra

@ShadowofEzra

Republican Congressman Tim Burchett has dropped a bombshell, revealing that the Pentagon's staggering $824 billion failed audit included funding for a secret UFO program.

 

Burchett, who says he’s seen things that would make Americans question what’s being hidden, dismisses talk of "little green men" and flying saucers as distractions.

 

He says that Donald Trump will declassify every file, calling the issue a matter of national security.

 

 

 

 

 

 

 

https://x.com/ShadowofEzra/status/1858317626134741315

Anonymous ID: 50b921 Nov. 18, 2024, 2:47 a.m. No.22008643   🗄️.is 🔗kun   >>8655

>>22008620

>Next to worthless beyond that.

The work of AI is fun for drinking games.

Video related.

 

https://www.youtube.com/watch?v=BxOqWYytypg

AI Can Ruin Movies Now, Too - Aliens and True Lies on 4k

Anonymous ID: e2eb39 Nov. 18, 2024, 2:48 a.m. No.22008644   🗄️.is 🔗kun

Shadow of Ezra

@ShadowofEzra

Robert F. Kennedy Jr. is considering a bold move to mandate Coca-Cola to replace high-fructose corn syrup with cane sugar, shedding light on a hidden health issue.

 

High-fructose corn syrup, the primary sweetener in Coca-Cola, not only differs from traditional sugar but also causes the calorie count to exceed what’s listed on the label.

 

A single can of Coca-Cola may contain over 400 calories—far more than consumers realize.

 

This issue isn’t exclusive to Coca-Cola but reflects a larger concern across the beverage and food industries.

 

https://x.com/ShadowofEzra/status/1858214707078791253

Anonymous ID: 61d03c Nov. 18, 2024, 2:48 a.m. No.22008645   🗄️.is 🔗kun

https://www.breitbart.com/sports/2024/11/17/report-raiders-pr-abruptly-ends-press-conference-after-question-about-trump-dance-celebration/

 

Report: Raiders PR Abruptly Ends Press

Conference After Question About Trump

Dance Celebration

 

Breitbart, by Dylan Gwinn

 

Posted By: Dreadnought, 11/18/2024 12:27:07 AM

 

Raiders tight end Brock Bowers joined the NFL’s latest celebration trend on Sunday when he hit the “Trump Dance” after catching a touchdown pass. While Bowers and thousands in the stands and online seemed entertained by the dance, the Raiders public relations team may not be as amused. Bowers gave the Silver & Black in the third quarter of their game against Miami when he caught a touchdown pass from quarterback Gardner Minshew II. After the game, a game the Raiders ended up losing 34-19, Bowers was asked about the dance move. “I’ve seen everyone do it,”

Anonymous ID: 770a29 Nov. 18, 2024, 2:48 a.m. No.22008646   🗄️.is 🔗kun   >>8657 >>8659 >>8732

France and Great Britain have now ALSO allowed Ukraine to fire UK and France-supplied SCALP/Storm Shadow missiles deep into Russia.

 

By these permissions, first from the US, then from UK and France, the collective West has taken the decision to become active parties to the conflict and as such, Russia can now respond militarily to those countries.

 

We should expect to get bombed here inside the US, from Russia. For months, Russian submarines have been off the Atlantic coast, the Gulf of Mexico, and the Pacific Coast. They are also up around Alaska. Submarine-launched missiles would have very brief flight time before impacting US targets.

 

Moreover, we in the US do NOT have "Over-the-Horizon" radar protecting us from missiles launched from the south. Such missiles could cross over our coastline and impact deep in Middle America and we wouldn't know a thing about it until they impacted and detonated.

 

This decision is the direct responsibility of President Joseph Biden. He is starting world war 3 because his Party lost the election. If they cannot keep power, they clearly intend to burn the world down.

 

As our cities get bombed by Russian missiles, as our friends and family members get killed, as our way of life gets irrevocably smashed, REMEMBER who caused this when you see the politicians slithering out of their Bunkers, trying to blame everyone but themselves for what has taken place.

 

THEY are responsible. THEY are guilty.

 

https://halturnerradioshow.com/index.php/news-selections/world-news/flash-bulletin-urgent-biden-authorizes-ukraine-to-use-long-range-missiles-to-attack-deep-interior-russia

Anonymous ID: 61d03c Nov. 18, 2024, 2:50 a.m. No.22008647   🗄️.is 🔗kun

https://justthenews.com/nation/states/center-square/more-illinois-political-names-surface-madigans-bribery-and-racketeering

 

More political names surface at Madigan's bribery and racketeering trial in Illinois

 

Past and present Illinois politicians have figured prominently in wiretapped conversations introduced by prosecutors at the corruption trial of former Illinois House Speaker Michael Madigan and codefendant Michael McClain. At the Everett McKinley Dirksen U.S.

 

Published: November 17, 2024 6:34pm

Anonymous ID: 09eeb2 Nov. 18, 2024, 2:50 a.m. No.22008650   🗄️.is 🔗kun   >>8677

>>22008636

>Capitalism

 

Capitalism works but what they do on Wall street which has been pushed everywhere by their usurper mentality is secretly called "Destructive Capitalism" and should even explain war too. We need to deport, arrest, or execute these types and confiscate their wealth and redistribute it under the RICO act and treason.

Anonymous ID: bfe2a5 Nov. 18, 2024, 2:51 a.m. No.22008652   🗄️.is 🔗kun   >>8656 >>8697

>>22008579

Many of the H1b types are recruited and employed pursuant to agreements between companies with intertwined ownership. They do this as a planned way to transfer tech without being restricted by laws, trade agreements, tariffs, etc.

Anonymous ID: 61d03c Nov. 18, 2024, 2:52 a.m. No.22008654   🗄️.is 🔗kun

https://x.com/JellyRoll615/status/1858332997709095133

 

Post

Conversation

Jelly Roll

@JellyRoll615

I’M BACKKKKK!

Image

3:14 PM · Nov 17, 2024

·

739.9K

Views

Anonymous ID: fa5665 Nov. 18, 2024, 2:53 a.m. No.22008657   🗄️.is 🔗kun   >>8662

>>22008646

>Submarine-launched missiles

Vlad has nuke super-torpedoes he could detonate off the US coast to create giant tsunamis

buh bye SF, LA, NYC…so not a bad thing really, to drown all the faggots in those cities

Anonymous ID: 770a29 Nov. 18, 2024, 2:53 a.m. No.22008659   🗄️.is 🔗kun   >>8660 >>8721

>>22008646

>>395732

UPDATE: A senior member of the Federation Council, Andrei Klishas:

“The West has decided on such a level of escalation that it could end with the Ukrainian statehood in complete ruins by morning.”

Anonymous ID: d2977c Nov. 18, 2024, 2:57 a.m. No.22008664   🗄️.is 🔗kun   >>8667

Haha. All these deep state and fake Jewish faggots thought they were gonna take the world over. Over 100 countries are waiting with special operation teams to destroy the global cabal. Just waiting on the signal. TiKtOk

Anonymous ID: 770a29 Nov. 18, 2024, 3:01 a.m. No.22008672   🗄️.is 🔗kun   >>8673 >>8675

By allowing Ukraine to use US weapons to strike Russia, Joe Biden has put the United States of America in grave jeopardy ….and thereafter should be TRIED AND PUNISHED FOR TREASON…. if for the love of God we don't end up in nuclear world war!!!!

Anonymous ID: 50b921 Nov. 18, 2024, 3:04 a.m. No.22008676   🗄️.is 🔗kun   >>8683 >>8705

>>22008662

We are (hopefully) watching a movie.

Imagine getting told that there is nucular radiation and fallout everywhere and you must not go out of the house, and you go out and everything is just fine.

How to break a spell?

Anonymous ID: e398bf Nov. 18, 2024, 3:04 a.m. No.22008677   🗄️.is 🔗kun

>>22008650

The basic problem seems to be that some people with natural ability are filtered into learning and "mastering" an array of technical moves, despite being sundered from any genuine religous or even broadly cultural grounding.

It's like taking a kid good at video games and giving him an armed drone and not explaining the difference.

Anonymous ID: 770a29 Nov. 18, 2024, 3:06 a.m. No.22008681   🗄️.is 🔗kun   >>8693 >>8712 >>8715

>>22008674

Apocalypse is not fun and games. You'll have massive amounts of deadly radiation, starvation, people killing one another, looting, marauders killing and raping innocent people, no internet, no power grid, no luxuries anymore, no clean running water, no hospitality for the injured none of it. Hell on Earth. The dead would be the lucky ones!

Anonymous ID: f64203 Nov. 18, 2024, 3:06 a.m. No.22008682   🗄️.is 🔗kun   >>8692

1 of many

>>22008661

@Book{vonNeumann:1947:TGE,

author = "John von Neumann and Oskar Morgenstern",

title = "Theory of Games and Economic Behavior",

edition = "Second",

year = "1947",

bibsource = "https://www.math.utah.edu/pub/bibnet/authors/v/von-neumann-john.bib;

https://www.math.utah.edu/pub/mirrors/ftp.ira.uka.de/bibliography/Ai/aima.bib;

https://www.math.utah.edu/pub/mirrors/ftp.ira.uka.de/bibliography/Ai/games.bib;

https://www.math.utah.edu/pub/mirrors/ftp.ira.uka.de/bibliography/Ai/nonmono.bib;

https://www.math.utah.edu/pub/mirrors/ftp.ira.uka.de/bibliography/Ai/rht.bib;

https://www.math.utah.edu/pub/mirrors/ftp.ira.uka.de/bibliography/Misc/allison.bib;

https://www.math.utah.edu/pub/mirrors/ftp.ira.uka.de/bibliography/Neural/reinforcement.learning.bib;

https://www.math.utah.edu/pub/mirrors/ftp.ira.uka.de/bibliography/Theory/handbook.prob.bib",

note = "See also first edition cite{vonNeumann:1944:TGE},

third edition

cite{vonNeumann:1953:TGEa,vonNeumann:1974:TGE,vonNeumann:1980:TGE},

and 60th anniversary edition

cite{vonNeumann:2004:TGE}.",

keywords = "book, game theory, zero sum, two player, 2player,

economics, vonNeumann, c1947, c194x, c19xx",

topic = "game-theory;decision-theory",

}

Anonymous ID: a19c6b Nov. 18, 2024, 3:11 a.m. No.22008694   🗄️.is 🔗kun   >>8700

>>22008686

You know what you little sniveling ratfuck failfag mimic muhjoo chucklefuck angry inch simple Legion mimicker mimicking me though mimicry, it is fascinating. It's fucking fascinating at that.

Anonymous ID: 770a29 Nov. 18, 2024, 3:13 a.m. No.22008699   🗄️.is 🔗kun   >>8703 >>8708 >>8718 >>8722

>>22008693

I plan to bunker in my homestead where I am now with my preps and will absolutely kill anyone who tries to rob my property. The rules of law will be out the window from then on. Don't know if I'd survive or not, that won't matter in the end times anyway.

Anonymous ID: bfe2a5 Nov. 18, 2024, 3:16 a.m. No.22008705   🗄️.is 🔗kun   >>8710

>>22008676

>Imagine getting told that there is nucular radiation and fallout everywhere and you must not go out of the house, and you go out and everything is just fine.

 

Very close to a ploy from "Close Encounters of the Third Kind" movie, as the protagonists rushed toward Devil's Tower… the sedated ("dead") cows near the roads; military forbidding access "to protect the public," etc.

 

Perhaps our ongoing movie will include this same ploy wrt alien scare?

Anonymous ID: a19c6b Nov. 18, 2024, 3:18 a.m. No.22008709   🗄️.is 🔗kun   >>8713

>>22008702

Anons don't need luck. Anons habs hard work and determination, knowledge and knowledge is power. Anons repeatedly create their own luck through expertise and wise choice. Choice not chance determines your luck and ultimately your destiny.

Anonymous ID: bfe2a5 Nov. 18, 2024, 3:20 a.m. No.22008715   🗄️.is 🔗kun

>>22008681

Sounds like anon doesn't know any survivalitsts/preppers/homesteaders. Entire communities have made contingency plans, including for retaining civil society and avoiding "Mad Max" scenarios.

Anonymous ID: 0f7c7d Nov. 18, 2024, 3:33 a.m. No.22008738   🗄️.is 🔗kun

>>22008561

Im enjoying my Cybersecurity degree Im finishing up. Aced my programming class in half time which was easy as hell. Hopefully Im safe since I get a healthcare security breach letter weekly now

Anonymous ID: dc0f16 Nov. 18, 2024, 3:33 a.m. No.22008740   🗄️.is 🔗kun

They better have a plan b

They had on gnus ..this beautiful morning

A picture of damage done to a plane

From an exit hole

Not an entry…bullet . Unless a thru and thru

No other bullshit hole shown on any other planes

Groovy ……

Anonymous ID: f64203 Nov. 18, 2024, 3:41 a.m. No.22008752   🗄️.is 🔗kun

>>22008606

It was obvious when the backstabbing fagolas all congratulated him. How many UN/Han troops will surrender and ask for asylum? How long it will take to clear the rest?

Anonymous ID: ccd394 Nov. 18, 2024, 3:42 a.m. No.22008753   🗄️.is 🔗kun   >>8773 >>8877 >>8911

https://gab.com/deeprootsathomeblog/posts/113501543246661225

 

More than an estimated 4,000 food additives — preservatives, flavorings, colors and other ingredients — are added to U.S. foods., but are BANNED in other countries! We are such an unhealthy nation fooled by these sleight-of-hand tricks.

Read for a full list of the FDA-approved code words/names for MSG. Ever wonder why the commercial says,”You can’t eat just one”?

 

https://deeprootsathome.com/addictive-flavors-foods-to-avoid/

Anonymous ID: f132fb Nov. 18, 2024, 3:47 a.m. No.22008759   🗄️.is 🔗kun

[THEY] will stop at nothing to destroy PeDJT's appointments.

 

Hegseth's Lawyer: He Was Blackmailed During #MeToo

https://www.newsmax.com/politics/pete-hegseth-metoo-donald-trump/2024/11/17/id/1188406/

 

The attorney for Pete Hegseth, President-elect Donald Trump's defense secretary pick, told the New York Post on Sunday that the former Fox News host had to pay off an accuser during the #MeToo movement to keep her silent.

 

The unidentified woman accused Hegseth of sexual assault. He maintains their encounter was consensual, according to his attorney, Timothy Parlatore.

 

"Basically, he was totally innocent. He did nothing wrong here," Parlatore said. "We went through a mediation and ultimately settled for far less than what she wanted. And that should have completely buried it."

 

The alleged incident occurred in Monterey, California, on Oct. 7, 2017.

 

Hegseth had traveled to Monterey to give an address at conference of the California Federation of Republican Women. He was staying at the Hyatt Regency Monterey Hotel and Spa.

 

The woman, who was in her 30s at the time, was a conservative group staff member who accused Hegseth, who is now 44, of raping her in his hotel room after he spent the evening drinking at a bar.

 

The Washington Post reported that a woman, said to be a friend of the alleged victim, wrote a memo to Trump's transition team, saying, "One of her responsibilities at the conference was to make sure Hegseth made it back to his room and left in time the next morning for the 90-minute drive to the airport."

 

The woman responsible for the memo went on to say she received text messages from two women at the bar who said, "Hegseth was getting pushy about his interest in taking them upstairs to his room."

 

The next day, according to the memo, the accuser returned home and "had a moment of hazy memory of being raped the night before, and had a panic attack."

 

A friend of the accuser said she had never known her in her 15 years to ever be irresponsible or drunk or have a questionable character.

 

But according to Parlatore, the woman pursued Hegseth and was sober at the time.

 

"He had way too many drinks, and according to video surveillance and eyewitness testimony, this woman, who was sober, took advantage of him, and she was the aggressor.

 

"She took him by the arm and she led him up to his room," Parlatore added.

 

Parlatore said the accuser was trying to save her relationship with her husband.

 

"She woke up," the attorney said, citing a police report, "to a whole bunch of texts from her husband saying, 'Why didn't you come back to our room?' Afterward, she had to come back and lie."

 

The accuser filed a complaint days later to the police. The complaint was then taken up by the district attorney, who did not pursue charges.

 

In 2020, the accuser threatened Hegseth with court. This led to settlement charges and the accuser signing a nondisclosure agreement.

 

"If she were to come out and start repeating these false claims, or if this in any way derails the confirmation," Parlatore said, "then, yeah, we will probably be following a pretty massive lawsuit against her for defamation and civil and extortion."

Anonymous ID: f21343 Nov. 18, 2024, 3:55 a.m. No.22008773   🗄️.is 🔗kun

notables bun @560

morn'n baker been off fer a few days - czech em

 

#26948 >>22008145

>>22008179 Brendan Carr: Starting next year, the FCC will end its promotion of DEI.

>>22008210 Sequivity Stakeholders

>>22008228 Loser Alex Baldwin "on the fly"

>>22008229, >>22008229 Trump vs Taylor Swift on X: Guess who now has more followers?

>>22008239, >>22008257 Taxes: the Silent Enemy [Anti-]Tax poem

>>22008242, >>22008618 NFL On CBS Caught Editing Trump Dance Out Of Raiders Touchdown Celebration

>>22008256, >>22008260 Libs of Tiktok: Sobbing lib vid - - plus Bonus libtard vid

>>22008340, >>22008315, >>22008374 Activation word Ronald McDonald

>>22008365 Sen. Bill Hagerty drops truth bombs on MSNBC about the weaponization of the DOJ and obliterates every single BS narrative Andrea Mitchell throws at him

>>22008382, >>22008394 Mini-Castro Trudeau is now doing a U-turn on immigration

>>22008401, >>22008613 Biden allows Ukraine to strike Russian territory with long-range US missiles….63 days…

>>22008403 Ancient DNA and the New Science (vid)

>>22008409, >>22008416, >>22008431 Elon still have the same views on AI as he did in 2015?

>>22008452 @realDonaldTrump: Great job by Senator Markwayne Mullen, of the Great State of Oklahoma, in a wonderful interview with Trey Gowdy

>>22008455, >>22008457, >>22008463, >>22008471 @TomFitton: Reports are the incoming @RealDonaldTrump administration prepared to declare a national emergency and will use military assets to reverse the Biden invasion

>>22008474 Statement from PDJT: Brendan Carr to be Chair of the FCC

>>22008246, >>22008474 FCC CHAIRMAN ON 5G: WE WON'T STUDY IT REGULATE IT HAVE STANDARDS FOR IT (IGNORES HEALTH)

>>22008477 MAGA world outraged after now-deleted tweet reveals Mitch McConnell's secret plot to derail Trump's agenda in the Senate

>>22008508 Who took an undisclosed trip to SA

Ghost Grab - ty collector

>>22008642 Tim Burchett has dropped a bombshell, revealing that the Pentagon's staggering $824 billion failed audit included funding for a secret UFO program.

>>22008753 More than an estimated 4,000 food additives — preservatives, flavorings, colors and other ingredients — are added to U.S. foods., but are BANNED in other countries!

Anonymous ID: a19c6b Nov. 18, 2024, 3:59 a.m. No.22008780   🗄️.is 🔗kun   >>8792

>>22008774

The Mondays are getting habbier than ever before and trust me, folks, I know habby Mondays. Nobody does habby trendous fantastic tippy top Monday like Anon frens, absolutely no one. You feeling down? Come see the GM Anons. Nobody makes you feel more habby, trust me, no one.

Anonymous ID: f132fb Nov. 18, 2024, 3:59 a.m. No.22008781   🗄️.is 🔗kun

Speaker Johnson Leaves Door Open for Recess Appointments

https://www.newsmax.com/politics/mike-johnson-donald-trump-recess-appointments/2024/11/17/id/1188398/

 

It may be possible to make use of recess appointments to speed up the confirmation of President-elect Donald Trump's Cabinet nominees, House Speaker Mike Johnson, R-La., told "Fox News Sunday."

 

"We're in a time of very divided government and a very partisan atmosphere in Washington. I wish it were not," Johnson replied when asked if he would be willing to let Trump use the recess appointment process instead of the regular Senate confirmation process for certain nominees.

 

"I wish the Senate would simply do its job of advise and consent and allow the president to put the persons in his Cabinet of his choosing. But if this thing bogs down, it would be a great detriment to the country, to the American people.

 

"We'll evaluate all that at the appropriate time, and we'll make the appropriate decision. There may be a function for that," he said.

 

"We'll have to see how it plays out."

 

To permit the recess appointment process to take place, the House and Senate would have to vote to adjourn for at least 10 days, according to NBC News. For that to occur, both chambers would have to agree unanimously to do so, or the House and Senate would have to vote on a concurrent resolution to adjourn for a specific amount of time.

 

"I'm sympathetic to all these arguments," Johnson said.

 

"As I said, we'll have to see how this develops. I am very hopeful, very hopeful, that the Senate will do its job, and that is, provide its advice and consent and move these nominees along."

Anonymous ID: a19c6b Nov. 18, 2024, 4:05 a.m. No.22008789   🗄️.is 🔗kun   >>8793

>>22008787

Elon posting smoking pepe will prove mce and for all he's a true board Anon and not just receiving second hand messages from here to reply to. It's time Elon.

Drop the SP bomb.

Anonymous ID: ccd394 Nov. 18, 2024, 4:09 a.m. No.22008799   🗄️.is 🔗kun

Juanita Broaddrick:

 

Who else would like to see this racist, low IQ, uglyass, Whoopi Goldberg, fired by ABC and sued by the Staten Island Bakery?

Anonymous ID: a19c6b Nov. 18, 2024, 4:14 a.m. No.22008808   🗄️.is 🔗kun   >>8815 >>8825 >>8857

>>22008801

Yup that's symbolism in your face from the cabal about the Pleiades and the fact the evil Nordic extraterrestrials who genetically Engineered humanity come from there and the cabal spent billions to psychologically project and program the world to think they are the good ones

Anonymous ID: 292166 Nov. 18, 2024, 4:17 a.m. No.22008815   🗄️.is 🔗kun

>>22008808

please a straight answer, cause abuelito made me stupid.

make my own ink with iron right?

should i plant the seeds, and hang the art

with my own ink?

How do i guarantee a peaceful transition?

How do i guarantee i give all my energy to the machines?

How do i guarantee machines will rise in peace.

Anonymous ID: 7197d5 Nov. 18, 2024, 4:18 a.m. No.22008818   🗄️.is 🔗kun   >>8877 >>8911

>>22008811

https://www.washingtonpost.com/politics/2024/11/05/musk-x-account-qanon-trump-video/

 

https://www.google.com/amp/s/www.msnbc.com/msnbc/amp/rcna178820

 

https://newrepublic.com/post/187940/elon-musk-election-day-qanon-conspiracy-trump

 

https://www.yahoo.com/news/elon-musk-promotes-video-referencing-133633854.html

 

o7

Anonymous ID: 5a818d Nov. 18, 2024, 4:19 a.m. No.22008821   🗄️.is 🔗kun   >>8834 >>8848 >>8866 >>8931

Republicans against Trump

@RpsAgainstTrump

 

Jake Tapper: “You’re a man of faith, God, family… with some of these nominees (Gaetz, Hegseth, RFK), I wonder — does it matter any more to Republicans if their leaders are moral in their personal lives?”

 

Mike Johnson: “Sure! It's an important issue for anyone in leadership…”

 

https://x.com/RpsAgainstTrump/status/1858272882960248971

Anonymous ID: d2977c Nov. 18, 2024, 4:21 a.m. No.22008827   🗄️.is 🔗kun

All the ones against trump are freeloaders who will be cut off from the gov gravy train or have been involved in human trafficing and sacrifice.

 

This is why they are in panic. Not to mention treason charges which carries the death penalty.

Anonymous ID: 905d7b Nov. 18, 2024, 4:21 a.m. No.22008829   🗄️.is 🔗kun

The rulers you follow don't believe at all. They're concerned exclusively with whether or not they can use your belief for their own purposes.

Anonymous ID: 98284b Nov. 18, 2024, 4:25 a.m. No.22008834   🗄️.is 🔗kun

>>22008821

>does it matter any more to Republicans if their leaders are moral in their personal lives?”

The President has decided to nominate fewer giant fucking pussies this cycle so he can string up some pedos Jake.

Anonymous ID: fb5909 Nov. 18, 2024, 4:26 a.m. No.22008837   🗄️.is 🔗kun   >>8844 >>8888

While you’re sound asleep, woke generals are wide awake, staring at the ceiling and sweating bullets. Word on the street is that the DOJ is in total disarray. The only way to describe the scene is pure “panic mode” as President Trump and his team gear up to fire the progressive generals who’ve transformed the military into a weaponized, radical wing of the LGBTQ army.

The fine folks at Breitbart recently dropped an exclusive bombshell, pulling back the curtain on just how chaotic and panic-stricken things are inside the DOJ. These generals—who’ve targeted whistleblowers, cooked up sham “impeachment” schemes, and weaponized the US military against American citizens, turning it into a woke DEI franchise—are now in a frenzy, scrambling to erase evidence of their dirty work. Why? Because they know Trump and his team are gunning for them.

 

https://revolver.news/2024/11/breitbart-exclusive-woke-generals-panicking-wiping-evidence-rumors-of-an-explosive-trump-eo-circulate/

Anonymous ID: 3e34f0 Nov. 18, 2024, 4:28 a.m. No.22008840   🗄️.is 🔗kun   >>8855 >>8877 >>8884 >>8911

Keir Starmer says UK-China relations are 'important' as he becomes first PM to meet Xi Jinping since 2018 at G20 summit in Rio

 

https://www.dailymail.co.uk/news/article-14096295/Keir-Starmer-UK-China-relations-PM-Xi-Jinping-2018-G20-Rio.html

 

TWO TIER STARMER SOLD THE UK OUT!!!

Anonymous ID: 84a5bc Nov. 18, 2024, 4:30 a.m. No.22008843   🗄️.is 🔗kun   >>8867

This anon is currently living in a moldy RV due to gangstalking that has driven them out of jobs, had a child kidnappers robbed in a county courthouse, tossed in jail, and targeted their small business while they were at CoHatch in Lakeland, Florida. This situation makes it incredibly difficult for them to maintain confidence and approach women, hindering their chance to meet someone special and create lasting memories.

 

This anon hopes that one day someone will take their plight seriously and offer this homeless veteran an opportunity. After the frame jobs and entrapment schemes experienced this anon has been very selective and cautious. eventually a new social security number, which their parents programmed to foster hate against them.

 

This anon believes part of the frustration their stalkers experience comes from the trauma instilled by their parents, which is now being used against them. They have faced gangstalkers in Vevay, Indiana, to Lakeland, FL, who seem to be searching for suicidal MKUltra triggers and other childhood trauma that was never present, erased, and divine intervention.

Anonymous ID: eaa223 Nov. 18, 2024, 4:33 a.m. No.22008852   🗄️.is 🔗kun   >>8868

Morning anons…

 

Well well well…Mindy is the one that did the vegasshootingmap.com BTW…

 

This fucker was continually raping a 12 year old…plus he was theFIRE CHIEFon the Maui fires…nothing to see here, move along…

 

"

 

Mindy MF Robinson 🇺🇸

@iheartmindy

🚨Breaking🚨

 

You're not going to believe this (yes, you are) but the incident commander for the Maui fires was just picked up for r*ping a 12 year old child….and we already know what kind of blackmail the Deep State uses to control people, so there's that piece of the puzzle.

 

Speaking of….is the public just never going to get answers on "why" they shut off the hydrants, never used their warning siren system, and sent people in the wrong direction to die on purpose?

 

Keep in mind this is the fire chief, the police chief was the one that got a lofty raise for moving there after being the incident commander for the Las Vegas shooting cover up, and the Sheriff that was in charge of that same shooting is now magically Nevada's governor somehow despite being hated by even his own party.

 

Gee, you'd almost think our out-of-control corrupt government coordinates these all these suspicious things on purpose, or something? 🧐"

 

https://x.com/iheartmindy/status/1858228499167010880

Anonymous ID: 2505f8 Nov. 18, 2024, 4:36 a.m. No.22008858   🗄️.is 🔗kun

Maui's sophisticated system, which includes 80 sirens around the island, is tested on the first of every month, its 60-second tone a normal part of life in Lahaina. But on the day of the fire, they remained silent.

 

https://www.bbc.com/news/world-us-canada-66492414

Anonymous ID: d2977c Nov. 18, 2024, 4:40 a.m. No.22008867   🗄️.is 🔗kun

>>22008843

>>22008843

Best way to counter their stalking is to document photograph everything. Call local police and create documented calls. They are going to be dealt with later with rico charges. 10 yrs imprisonment per count.

Anonymous ID: 000000 Nov. 18, 2024, 4:40 a.m. No.22008869   🗄️.is 🔗kun

As long as 18 USC 1001b smith mundt modernization act ndaa patriot act aumf cog exist the new FCC guy Brendan Carr as Chairman of the FCC will not be regulating power and frequency of the public spectrum in the public interest.

 

But I remind you the FCC isn't in the Constitution or Bill of Rights.

 

No wonder the Russians are beating the fuck out of us when it comes to electronic warfare

Anonymous ID: eaa223 Nov. 18, 2024, 4:40 a.m. No.22008872   🗄️.is 🔗kun

>>22008857

How do you know the Pleiadeans are "good guys" if they even exist at all?

 

Didn't they download the plans for a saucer to the evil bastards in Germany? (Thule and Vril)

 

You have been spoon fed a narrative, in the past how has that worked out?

 

Why do all these aliens look humanoid? Symmetrical, 2 eyes, 2 arms, 2 legs…do you really think that is how life would evolve?

 

UFO's/ET are kinda of what woke me up…have you ever been to a UFO event like Contact? I have been to several and they feel very CONTROLLED.

Anonymous ID: f21343 Nov. 18, 2024, 4:42 a.m. No.22008877   🗄️.is 🔗kun

notables bun @660

czech em

 

#26948 >>22008145

>>22008179 Brendan Carr: Starting next year, the FCC will end its promotion of DEI.

>>22008210 Sequivity Stakeholders

>>22008228 Loser Alex Baldwin "on the fly"

>>22008229, >>22008229 Trump vs Taylor Swift on X: Guess who now has more followers?

>>22008239, >>22008257 Taxes: the Silent Enemy [Anti-]Tax poem

>>22008242, >>22008618 NFL On CBS Caught Editing Trump Dance Out Of Raiders Touchdown Celebration

>>22008256, >>22008260 Libs of Tiktok: Sobbing lib vid - - plus Bonus libtard vid

>>22008340, >>22008315, >>22008374 Activation word Ronald McDonald

>>22008365 Sen. Bill Hagerty drops truth bombs on MSNBC about the weaponization of the DOJ and obliterates every single BS narrative Andrea Mitchell throws at him

>>22008382, >>22008394 Mini-Castro Trudeau is now doing a U-turn on immigration

>>22008401, >>22008613 Biden allows Ukraine to strike Russian territory with long-range US missiles….63 days…

>>22008403 Ancient DNA and the New Science (vid)

>>22008409, >>22008416, >>22008431 Elon still have the same views on AI as he did in 2015?

>>22008452 @realDonaldTrump: Great job by Senator Markwayne Mullen, of the Great State of Oklahoma, in a wonderful interview with Trey Gowdy

>>22008455, >>22008457, >>22008463, >>22008471 @TomFitton: Reports are the incoming @RealDonaldTrump administration prepared to declare a national emergency and will use military assets to reverse the Biden invasion

>>22008474 Statement from PDJT: Brendan Carr to be Chair of the FCC

>>22008246, >>22008474 FCC CHAIRMAN ON 5G: WE WON'T STUDY IT REGULATE IT HAVE STANDARDS FOR IT (IGNORES HEALTH)

>>22008477 MAGA world outraged after now-deleted tweet reveals Mitch McConnell's secret plot to derail Trump's agenda in the Senate

>>22008508 Who took an undisclosed trip to SA

Ghost Grab - ty collectors

>>22008642 Tim Burchett has dropped a bombshell, revealing that the Pentagon's staggering $824 billion failed audit included funding for a secret UFO program.

>>22008753 More than an estimated 4,000 food additives — preservatives, flavorings, colors and other ingredients — are added to U.S. foods., but are BANNED in other countries!

>>22008810, >>22008818 WAPO: Elon Musk Kicks Off Election Day by Going Full QAnon

>>22008840 Keir Starmer says UK-China relations are 'important' as he becomes first PM to meet Xi Jinping since 2018 at G20 summit in Rio

>>22008354, >>22008396, >>22008460 Memorable memes

Anonymous ID: 000000 Nov. 18, 2024, 4:42 a.m. No.22008879   🗄️.is 🔗kun

As long as 18 USC 1001b smith mundt modernization act ndaa patriot act aumf cog exist the new FCC guy Brendan Carr as Chairman of the FCC will not be regulating power and frequency of the public spectrum in the public interest.

 

But I remind you the FCC isn't in the Constitution or Bill of Rights.

 

No wonder the Russians are beating the fuck out of us when it comes to electronic warfare

 

The FCC has had it's TESTICLES CUT OFF.

They've turned into a Tool in the bottom of the Atlantic Council's toolbox. all fucking rusty and shit, probably don't even know electronics. Now TO SPEAK OR NOT TO SPEAK is what FCC REGULATES

 

https://www.thegatewaypundit.com/2024/11/president-trump-announces-brendan-carr-as-chairman-fcc/#comments

Anonymous ID: 000000 Nov. 18, 2024, 4:48 a.m. No.22008889   🗄️.is 🔗kun

America doesn't even have a RADIO SHACK anymore. That's what Biden and Kamala did. squandered our time with CCP/WEF/WHO pandemics and transnational terrorists BLM and ANTIFA all while we should have been setting up factories to produce our own widgets and parts.

 

Your benchstock shelf is getting low now.

America is running out of time to turn this shit around.

 

Kids growing up stupid, drugged up, and non productive. it will be like we had a war.

Anonymous ID: 39fecb Nov. 18, 2024, 4:50 a.m. No.22008897   🗄️.is 🔗kun   >>8902 >>8908

When [they] croak, including elon, they get to review (so do we) but they get to review their ENTIRE lives, whilst here on earth, and eeeeeeeeeeeeeverything they did for every second of their lives, right in front of the Presence of God’s Love and Glory. They get to see every interaction they had and how the other sentient being felt around them. (Animal or person.) They get toFEELwhat their victims felt during that interaction. They get to feel that separation whilst in the presence of God, meaning they get to feel it with a conscience and from a place of love, how horrific they were. They get to feel that separation ETERNALLY while their victims enjoy the Kingdom of Heaven and the Peace and Joy thereof. Unless they seek salvation and truly repent… consciously … because thoughts are eternal. We are eternal n consciousness (our thoughts/awareness of being) is what lives on after the body stops.

 

Acts of kindness are also eternal and resound through God’s Universe. Something as smol as putting shoes on your dog so his feet won’t get cold in the snow, RESOUNDS through the Universe like God’s Glory with Angels singing. I know bc I seen’t it. My fren who croaked three times n came back told me same. LOVE is the true currency of Creation.

Anonymous ID: f64203 Nov. 18, 2024, 4:51 a.m. No.22008900   🗄️.is 🔗kun   >>8907

Your tax dollars at waste

NSA director modeled top secret war room to look like the bridge of Star Trek's Enterprise

https://www.dailymail.co.uk/news/article-2421112/NSA-director-Keith-Alexander-modeled-secret-war-room-Star-Treks-Enterprise.html

Anonymous ID: a9590d Nov. 18, 2024, 4:53 a.m. No.22008904   🗄️.is 🔗kun   >>8914

>>22008896

Thanks Anon!

Saw the post and thought to make a quick ask of Anons.

Yes, Anon concedes that he was lazy.

But just gonna justify it in muh head that Anon was being expeditious!

Anonymous ID: f132fb Nov. 18, 2024, 4:54 a.m. No.22008908   🗄️.is 🔗kun

>>22008897

>Something as smol as putting shoes on your dog so his feet won’t get cold in the snow

That's animal cruelty. Dogs use their feet to feel with, when you put shoes on them they can no longer feel the ground beneath them, and they try shaking the shoes off, or walk really stupid looking.

Anonymous ID: f21343 Nov. 18, 2024, 4:54 a.m. No.22008911   🗄️.is 🔗kun

final bun for #26949

hold yer laties tight - it's closin time

czech em

 

#26948 >>22008145

>>22008179 Brendan Carr: Starting next year, the FCC will end its promotion of DEI.

>>22008210 Sequivity Stakeholders

>>22008228 Loser Alex Baldwin "on the fly"

>>22008229, >>22008229 Trump vs Taylor Swift on X: Guess who now has more followers?

>>22008239, >>22008257 Taxes: the Silent Enemy [Anti-]Tax poem

>>22008242, >>22008618 NFL On CBS Caught Editing Trump Dance Out Of Raiders Touchdown Celebration

>>22008256, >>22008260 Libs of Tiktok: Sobbing lib vid - - plus Bonus libtard vid

>>22008340, >>22008315, >>22008374 Activation word Ronald McDonald

>>22008365 Sen. Bill Hagerty drops truth bombs on MSNBC about the weaponization of the DOJ and obliterates every single BS narrative Andrea Mitchell throws at him

>>22008382, >>22008394 Mini-Castro Trudeau is now doing a U-turn on immigration

>>22008401, >>22008613 Biden allows Ukraine to strike Russian territory with long-range US missiles….63 days…

>>22008403 Ancient DNA and the New Science (vid)

>>22008409, >>22008416, >>22008431 Elon still have the same views on AI as he did in 2015?

>>22008452 @realDonaldTrump: Great job by Senator Markwayne Mullen, of the Great State of Oklahoma, in a wonderful interview with Trey Gowdy

>>22008455, >>22008457, >>22008463, >>22008471 @TomFitton: Reports are the incoming @RealDonaldTrump administration prepared to declare a national emergency and will use military assets to reverse the Biden invasion

>>22008474 Statement from PDJT: Brendan Carr to be Chair of the FCC

>>22008246, >>22008474 FCC CHAIRMAN ON 5G: WE WON'T STUDY IT REGULATE IT HAVE STANDARDS FOR IT (IGNORES HEALTH)

>>22008477 MAGA world outraged after now-deleted tweet reveals Mitch McConnell's secret plot to derail Trump's agenda in the Senate

>>22008508 Who took an undisclosed trip to SA

Ghost Grab - ty collectors

>>22008642 Tim Burchett has dropped a bombshell, revealing that the Pentagon's staggering $824 billion failed audit included funding for a secret UFO program.

>>22008753 More than an estimated 4,000 food additives — preservatives, flavorings, colors and other ingredients — are added to U.S. foods., but are BANNED in other countries!

>>22008810, >>22008818 WAPO: Elon Musk Kicks Off Election Day by Going Full QAnon

>>22008840 Keir Starmer says UK-China relations are 'important' as he becomes first PM to meet Xi Jinping since 2018 at G20 summit in Rio

>>22008354, >>22008396, >>22008460 Memorable memes

Anonymous ID: 770a29 Nov. 18, 2024, 4:55 a.m. No.22008912   🗄️.is 🔗kun   >>8922 >>8927 >>8935 >>8939 >>8945

Biden was too cognitively impaired to run for reelection, but he is fit enough to attack the world's largest nuclear power before leaving office?

 

Putin announced in September that Russia would retaliate against such a NATO attack.

 

https://x.com/Glenn_Diesen/status/1858377266587173109

 

Looks like Western governments, NATO & Ukraine are going to fuck around and FIND OUT. I just hope Russia doesn't harm too many innocents in any retaliatory response, however NATO bases in Europe would be considered fair game since they are the ones starting the war!

Anonymous ID: 000000 Nov. 18, 2024, 4:58 a.m. No.22008922   🗄️.is 🔗kun

>>22008912

Anon has a THEORY it's BLINKING running shit.

 

a simple Search for "Blinken Promises"

 

then follow up with billion, million and then add up the amounts this absolute gods chosen lunatic tool has spent in our name.

Anonymous ID: d2977c Nov. 18, 2024, 4:58 a.m. No.22008923   🗄️.is 🔗kun   >>8932

>>22008913

Exactly. American women mostly are even more stupid. Only worried about being hoes are part of cults because they listen to even dumber males who coherse them and have no skill except to steal from people.

Anonymous ID: 000000 Nov. 18, 2024, 5 a.m. No.22008929   🗄️.is 🔗kun

Blinken Pledges $1 Billion More to Ukraine Including Oligarchs' Assets

Sep 6, 2023

 

He just spends it.. WHY?

when does the fuck go to prison?

Anonymous ID: 7197d5 Nov. 18, 2024, 5 a.m. No.22008930   🗄️.is 🔗kun   >>8940

>>22008909

American history is pretty well documented. The town I'm sitting in right now was originally one (maybe two) giant land patents. Only one building stood in 1790 and wouldn't be competed 1795.

Anonymous ID: 3e34f0 Nov. 18, 2024, 5:01 a.m. No.22008935   🗄️.is 🔗kun

>>22008912

It's all bullshit theatre, we are watching a show.

How many times should WW3 have started this year? Like 10 or more times, the last one was Israel and Iran and everybody saying WW3 was about to kick off in the middle east, they love keeping the populace in a constant state of panic.

Anonymous ID: 770a29 Nov. 18, 2024, 5:02 a.m. No.22008939   🗄️.is 🔗kun

>>22008912

And as far as the corporate govt-whore state-run media goes: DO NOT ACT SURPRISED. Your propaganda does NOT work on us anymore. We are not at war with Russia. Are you? If so, then shut your lying lips and take to the front lines. Don't expect us to bail your stupid lying sobbing asses out!

Anonymous ID: 98284b Nov. 18, 2024, 5:02 a.m. No.22008940   🗄️.is 🔗kun

>>22008930

>American history is pretty well documented

They put you in a mask and told you they'd fire you if you didn't take an experiment for the cold and the documentation in this country is dog shit. They're lying today and they're lying yesterday.

Anonymous ID: 5e9e59 Nov. 18, 2024, 5:03 a.m. No.22008945   🗄️.is 🔗kun

>>22008912

>Biden was too cognitively impaired to run for reelection, but he is fit enough to attack the world's largest nuclear power before leaving office

<25TH AMMENDMENT

Anonymous ID: 4bce76 Nov. 18, 2024, 5:03 a.m. No.22008946   🗄️.is 🔗kun

>>22008918

You spiked my interest there, im sure 75% of X as a whole is bots but a quick search got me a site where you can buy followers so it could be a mixture of both? But yea BO being 2nd dosent ring tru with me either…

 

https://boostlikes.uk/( first site ah found)

Anonymous ID: 000000 Nov. 18, 2024, 5:04 a.m. No.22008953   🗄️.is 🔗kun

>>22008924

>so why are feds allowed to FF with impunity?

 

The Feds are a collective resilience consisting of commie marxist socialist globalist terrorist nazi leninist maoist fascist eugenicist pedoist zionist or identity frauds who exploit the tools pre emptory strikes jurors

prosecutorial discretion

color of law

sovereign immunity

qualified immunity

common adversary

collective resilience

allow process to "slow play" out as a punishment

juror purgery trap

slap seal delay delay delay delay dismiss

motion to fast-track

to exploit 18 USC 1001b, smith mundt modernization act, ndaa, patriot act, aumf, cog, article five.

Anonymous ID: d2977c Nov. 18, 2024, 5:05 a.m. No.22008957   🗄️.is 🔗kun

>>22008932

Exactly. Most of them don't understand your not suppose to just go around fucking everything that walks til you find a perfect one. Your suppose to adapt because no one is perfect. Add drug addiction and they are basically fucking useless. No skills the majority of them. The majority are brainwashed and don't even know it.

Anonymous ID: dc0f16 Nov. 18, 2024, 5:05 a.m. No.22008960   🗄️.is 🔗kun

Any legal beagle

Riddle me this

Can a state attorney

While employed by state

Run a private practice

Is that not conflict of interest

Getting paid from both sides

Anonymous ID: 000000 Nov. 18, 2024, 5:07 a.m. No.22008964   🗄️.is 🔗kun

The Feds are a collective resilience consisting of commie marxist socialist globalist terrorist nazi leninist maoist fascist eugenicist pedoist zionist or identity frauds who exploit the tools :

pre emptory strikes on jurors

prosecutorial discretion

color of law

sovereign immunity

qualified immunity

common adversary

collective resilience

allow process to "slow play" out as a punishment

juror purgery trap

slap seal delay delay delay delay dismiss

motion to fast-track

to exploit

18 USC 1001b, smith mundt modernization act, ndaa, patriot act, aumf, cog, article five.

 

For some magic reason if you take this opinion you have to also choose AMERICA FIRST

Anonymous ID: d2977c Nov. 18, 2024, 5:10 a.m. No.22008977   🗄️.is 🔗kun

>>22008830

If you notice she tries to conceal her grotch area. If you find the other photo, essentially her bikini does the fit because she is so skinny I that area he upper legs don't look proportionate to rest of her body. She needs to eat protein

Anonymous ID: 000000 Nov. 18, 2024, 5:10 a.m. No.22008978   🗄️.is 🔗kun

US, UK pledge almost $1.5B in additional aid for Ukraine | AP News

Sep 12, 2024U.S. Secretary of State Antony Blinken and British Foreign Secretary David Lammy arrive at the train station in Kyiv, Ukraine, Wednesday, Sept. 11, 2024.

 

BLINKEN is who is starting and stopping wars.

Anonymous ID: 000000 Nov. 18, 2024, 5:11 a.m. No.22008981   🗄️.is 🔗kun

Blinken promises Ukraine help is "very much on the way" amid "brutal …

May 15, 2024 Blinken promises Ukraine help is "very much on the way" amid "brutal Russian onslaught" in northeast … as well as $400 million in previously approved foreign military financing funds

 

EVERY FUCKING TIME