dChan - Q Origins Project Archive

TYB

TYB

so how many plainclothes LEO, mil, etc. 3-letters in D.C. Wednesday?

don't be stupid, anons.

>>12310838

https://en.wikipedia.org/wiki/Elagabalus

Russia now probing case of helicopter downed by Azerbaijan as murder -Interfax

MOSCOW (Reuters) - Russian military investigators are now treating the Nov. 9 downing of a helicopter over Armenia as "wilful murder", a more serious charge than the previous "death through negligence", Interfax news agency reported on Monday, citing a source.

A Russian Mi-24 helicopter was shot down over Armenia near the border with a region belonging to Azerbaijan, killing two crew members and injuring another, just few hours before a Moscow-brokered peace deal over Nagorno-Karabakh was reached.

Heavy fighting between Azerbaijan, which has the political backing of Turkey, and ethnic Armenian forces over the mountainous region had been raging for six weeks at the time of the incident.

Azerbaijan's Foreign Ministry said Azeri forces shot down the helicopter by accident, expressing apologies to Moscow and a readiness to pay compensation.

Interfax said on Monday, citing the source, that a case had initially been opened into a potential infringement of flying regulations that had resulted in deaths through negligence.

The reported switch to a murder charge, which could lead to a sentence of life imprisonment for those held responsible, may complicate relations between Moscow and Azerbaijan.

The conflict has tested Moscow's influence in the South Caucasus, a swath of the former Soviet Union it views as vital to defending its own southern flank.

https://www.yahoo.com/news/russia-now-probing-case-helicopter-142001553.html

Extraordinary warning to Trump by 10 former Pentagon chiefs

“The time for questioning the results has passed,” they wrote.

WASHINGTON — In an extraordinary rebuke of President Donald Trump, all 10 living former secretaries of defense are cautioning against any move to involve the military in pursuing claims of election fraud, arguing that it would take the country into “dangerous, unlawful and unconstitutional territory.”

https://www.nbcnews.com/politics/white-house/extraordinary-warning-trump-10-former-pentagon-chiefs-n1252704

Anonymous ID: dcb9e0 Jan. 4, 2021, 8:53 a.m. No.12310887 🗄️.is 🔗kun >>0894

-*–

Anonymous ID: 3bb08e Jan. 4, 2021, 8:53 a.m. No.12310888 🗄️.is 🔗kun >>1426

Qua non needs a spine today.

Anonymous ID: 870559 Jan. 4, 2021, 8:53 a.m. No.12310889 🗄️.is 🔗kun >>0999

TYB

Anonymous ID: 5a98bb Jan. 4, 2021, 8:53 a.m. No.12310890 🗄️.is 🔗kun >>0979

>former Pentagon chiefs

one of those words is important.

>>12310622 lb

>>12310858 lb

Anonymous ID: ef5c37 Jan. 4, 2021, 8:53 a.m. No.12310893 🗄️.is 🔗kun >>0920

https://www.theepochtimes.com/exclusive-over-432000-votes-removed-from-trump-in-pennsylvania-data-scientists-say_3642202.html

Anonymous ID: dcb9e0 Jan. 4, 2021, 8:54 a.m. No.12310894 🗄️.is 🔗kun >>0903

>>12310887

Anonymous ID: aee2a0 Jan. 4, 2021, 8:54 a.m. No.12310896 🗄️.is 🔗kun >>1599

>>12309477

>>12309477 PB

>In regards to Lin Wood, let's analyze a few points:

>A. He is stating that Chief Justice Roberts adopted his children through Epstein.

>B. Chief Justice Roberts adopted his children for a pedophilia sacrifice.

>C. Lin directly asks Roberts if he is a member of a cabal that requires minor children as an initiation fee.

>D. He claims that Roberts discussed Scalia's death before it occurred.

>E. It is stated that with absolute certainly that Epstein is still alive and cooperating.

>His claims acknowledge that there is a cabal that requires pedophile acts in order to be apart of their group. The Chief Justice of the Supreme Court is a part of these cabal and sacrifices his own adoptive children to be apart of this group. This group is so powerful that they are able to kill a supreme court justice. With only reviewing what Lin Wood is stating, he would be murdered just for even simply alluding to all of this. He basically just signed his death warrant. I don’t believe that Lin has a death wish, he knows what he just exposed puts a giant target on his back. The only rational explanation for his statements is that this cabal is no longer a threat, and the patriots are in control, and are about to Cross the Rubicon.

You cannot assume Patriots are in control by this. Never assume that. So many have died trying to uncover these truths and just know that the only protection he has were the keys of encryption and KAPPY had those keys, ASSANGE, etc and they are not protected! The tentacles are thousands and there is no way that protection is guaranteed.

Anonymous ID: 518715 Jan. 4, 2021, 8:54 a.m. No.12310897 🗄️.is 🔗kun >>0940

First time this is pronounced by someone with Nationwide name recognition on social media and hasn't been censored.

So either it is true, or disinformation the cabal wants spread around.

>>12310788 tyb

The Precipice doesn't allow for much to cheer about so many have to take solace in whatever they can.

guard comp'd? of course, they're all masons, right? doctors, local guys?

Chekt and TYB

>>12310894

>>12310834

>>12310377 lb

Here's my thought regarding this

"gun to rape/gun to kill" tweet

Lin posted last night/early this morning.

Up to this point, the whole "blackmail"

thing seemed like it was a

CAUGHT IN THE ACT type of blackmail.

So, all this pedocrap going on were with

total scumbags who were doing it

just because they could and someone

had a hidden cam then showed

'em the GOTCHA tape and that's it.

Handled and controlled.

Now, with Lin's "revelation", it comes

across as

COERCED IN THE ACT blackmail where

their defenders could say it was

AGAINST THEIR WILL/UNDER DURESS

type of crap and a segment of the

un-awakened genpop will have their

empathy switch FLIPPED ON and the

FEEL SORRY FOR THEM factor will

kick-in for those "being" blackmailed into

it.

Which, in their eyes will now look like VICTIMS!

Victims my ass.

So, there better be distinctions and

CLEAR LINES DRAWN and

WHOLE PICTURES PAINTED of

who's who and what's what!

Don't tell me the Lolita Island hoppers

were there because they were

FORCED TO BE THERE at gunpoint.

Same with the PODESTA PIZZAGATE

PARTY PEDOS.

Fuck dat shit. Ain't no way, motherfucker!

JOHN CARDILLO IS UNHINGED BECAUSE OF LIN WOOD

The new narrative is, "if you call out lunacy, you're jealous of the lunatic."

https://twitter.com/johncardillo/status/1346134634598440965

And his reply to someone

Lin Wood is not uncovering anything. And the numbers on the missing kids is wrong. Most are runaways who are quickly recovered.

https://twitter.com/johncardillo/status/1346135909939478530

Anonymous ID: 89d978 Jan. 4, 2021, 8:54 a.m. No.12310906 🗄️.is 🔗kun >>1023

Democrats call in the NG on Trump supporters but let Antifa tear down statues and burn churches down wtf kind of sense does that make??

Q#4881

Q !!Hs1Jq13jV6 10/17/2020 12:36:26

https://twitter.com/stinchfield1776/status/1317450311192223746

There is 'Q'. 1

There are 'Anons'. 2

There is no 'Qanon'. 3

Media labeling as 'Qanon' is a method [deliberate] to combine [attach] 'Q' to comments _theories _suggestions _statements [and ACTIONS] made by 2.

WHAT HAPPENS WHEN YOU CANNOT ATTACK THE INFORMATION [primary source 1]?

DO YOU ATTACK [& TYPECAST] THROUGH USE OF OTHERS?

Not all 'Anons' are authentic [injected].

You are correct, CJ.

Retweet @ 17:17 had meaning. [mathematical probability _17:17 [day after]?]

Do you believe it was a coincidence surgical removal of You Tube accounts occurred same day as 'Hunter' drop?

Welcome to the Digital Battlefield.

Q

exposure

Anonymous ID: cb893e Jan. 4, 2021, 8:55 a.m. No.12310911 🗄️.is 🔗kun >>0915

>>12310899

They are putting out Fear of the MIL ahead of what's coming.

That is Mutiny.

Still trying to convince the world it was Trump supporters who were violent on those days…scare tactic also to deter supporters from showing up.

Trump supporters marched from Freedom Plaza to the Supreme Court Building, across from the Capitol, during the day. Their activities and those of counterdemonstrators grew increasing tense and took a violent turn in the early evening. Videos posted to social media showed numerous incidents of shoving and punching as well as a fireworks explosion and a man shoving and knocking down one person before being shoved and punched unconscious himself by others.

https://apnews.com/article/nearly-2-dozen-arrested-trump-protests-2f5cfab681cf0bbee785fcc1a4209701

Bobby Piton insinuating a fake MSM hit piece coming out on him

BobbyPiton

@BobbyPiton3

Just got off the phone with a reporter (possibly MSM) That said, in IL it is against the law to record a conversation without permission. For the record, I did not grant permission to record my conversation. Since this is the case, I write up everything I discussed and share

10:32 AM · Jan 4, 2021·Twitter Web App

435

Retweets

9

Quote Tweets

1.4K

Likes

https://twitter.com/BobbyPiton3/status/1346117302719275010?s=20

>>12310911

blonde didn't trust you, he's still gonna give you your part

>Lin wood hasn't said anything we haven't heard before. Not sure what the big revelation is here.

Anonymous ID: 3f3bcd Jan. 4, 2021, 8:55 a.m. No.12310917 🗄️.is 🔗kun >>0957

>Most

Anonymous ID: dcb9e0 Jan. 4, 2021, 8:55 a.m. No.12310918 🗄️.is 🔗kun >>0922

>>12310903

tyb

Anonymous ID: 518715 Jan. 4, 2021, 8:56 a.m. No.12310920 🗄️.is 🔗kun >>1022

>>12310893

All you need to do is watch the replay of live fox broadcast to see the Trump Numbers actually go down after a count is reported.

They showed their theft in full view, but they are all so compromised, that even full evidence is not enough to force a narrative change.

Planefag update:

KC135 over Oak Ridge with 2 Navy jets doing DefPats.

Possible threat against Oak Ridge by Iran?

Anonymous ID: dcb9e0 Jan. 4, 2021, 8:56 a.m. No.12310922 🗄️.is 🔗kun >>0932

>>12310918

Hopefully he's building up to aliens and breeding programs.

That should really piss them off.

Forgot pics of tweets, kek sorry

Still waking up

Anonymous ID: 55dc86 Jan. 4, 2021, 8:56 a.m. No.12310926 🗄️.is 🔗kun >>0942

>10 former Pentagon chiefs

Ah, so those who were collectively in charge of the Pedo Pentagon? Gotcha.

Tyb

Twat is a social media platform for normies, and is not a back channel. He is getting normie eyes on it to wake up those he can, but more importantly this puts the fact that he has the dirt into the spotlight. Will hopefully provide a modicum of protection that others who have tried to expose this shit have not had.

He is forcing the dark out into the light -

This also is a way to establish a public 'chain of custody' for the info so it doesn't look like POTUS pulled it out of his ass to smear political opponents

>>12310239 (LB)

Who gave the order to stand down?

>>12310916

Cocaine is a hell of a drug.

Anonymous ID: dcb9e0 Jan. 4, 2021, 8:57 a.m. No.12310932 🗄️.is 🔗kun >>0945

>>12310922

Anonymous ID: aee2a0 Jan. 4, 2021, 8:57 a.m. No.12310933 🗄️.is 🔗kun >>0985

>>12310904

Stop typing please

They can only coerce you to do that if you are already corrupt to begin with

An incorruptible person would never be in that position

Anonymous ID: 1c13b5 Jan. 4, 2021, 8:57 a.m. No.12310934 🗄️.is 🔗kun >>1509

Thank you, Baker!

Bowser calling in the Koopa Troopas to deal with millions of red-hat Marios chanting MAGA? It's doesn't get much more Nintendo than that.

>>12310909

Excellent reply.

>>12310908

>You are correct, CJ.

who the fuck is cj?

>>12310897

I would definitely put him in the cabal territory.

Anonymous ID: 3bb08e Jan. 4, 2021, 8:57 a.m. No.12310941 🗄️.is 🔗kun >>1079

>>12310926

the pentagon always does things times 3 1/3 so . . . 10 former Chief equals Three Blind Mice in real world terms.

>>12310927

She needs to get her ass of the counter

get the bleach

Anonymous ID: dcb9e0 Jan. 4, 2021, 8:57 a.m. No.12310945 🗄️.is 🔗kun >>0956

>>12310932

>>12310927

Man those legs look inviting!

Anonymous ID: 91b08e Jan. 4, 2021, 8:58 a.m. No.12310947 🗄️.is 🔗kun >>1200

National Guard will have to make a choice. They are on the precipice too

>>12310927

fond memories

>>12310916

Lin Wood just throws out allegations with no proof.

>>12310873

Sorry, Q is gone fishing

But nice catch anon

Anonymous ID: 4c76f7 Jan. 4, 2021, 8:58 a.m. No.12310951 🗄️.is 🔗kun >>1239

"no DCNG personnel shall be armed during this mission…"

>>12310924

Time to start looking into John Cardillo

Anonymous ID: 7dbde4 Jan. 4, 2021, 8:58 a.m. No.12310953 🗄️.is 🔗kun >>1503

>>12310899

The Precipice refers (in my opinion) to the waking of the people.

This is how you March into battle. Massive numbers, armed to the teeth, singing your heart out.

>>12310946

dig, meme, pray!!!!!!!!!!!!!!!!!!!!!!!!!!

kek

Anonymous ID: dcb9e0 Jan. 4, 2021, 8:59 a.m. No.12310956 🗄️.is 🔗kun >>0967

>>12310945

>>12310917

I noticed that too

Anonymous ID: 666a80 Jan. 4, 2021, 8:59 a.m. No.12310958 🗄️.is 🔗kun >>0977

doesn't the head of Joint Chiefs of Staff act as Governor for D.C.

in all Title 32 vs. Title 10 matters?

"under the guise of riot control"

no mention of vax dispersal

Anonymous ID: 5af0a0 Jan. 4, 2021, 8:59 a.m. No.12310959 🗄️.is 🔗kun >>1521

3 or so million pissed off americans in DC while Congress gives American people 100 Billion in covid relief but then gives 700 Billion to other countries and gives away American jobs with recent unlimited cap to H1-B… I mean what could possibly go wrong??

Trump phone call: Democrats ask FBI for ‘immediate criminal investigation’ in new letter

https://www.independent.co.uk/news/world/americas/us-election-2020/trump-phone-call-fbi-georgia-b1782130.html

he sure draws lots of shills for doing merely that, doesn't he.

reconcile.

Lets open the Clinton/China can of worms.

https://www.thegatewaypundit.com/2017/11/ex-clinton-foundation-exec-linked-chinese-kindergarten-investigation-alleged-child-molestation/

Put Pepe in!

Anonymous ID: fd75bf Jan. 4, 2021, 8:59 a.m. No.12310966 🗄️.is 🔗kun >>1547

Last night I read the story of how it's always windy beside a certain church in Rome . . .

interesting story the wind was told to wait for the Devil, as they were travelling together.

this is supposed to have happened a long long time ago, the Devil went into the church because he had a meeting with the Je su its in dare.

well The Wind is still waiting for that meeting to conclude.

from Secret Rome, a small tome worth a read

>>12310956

He gave you proof and the proof has been out there since the first pizzagate drop in 2015. Nice try but fuck off.

Public recognition. Permeating the surface.

>>12310909

Well, anon's right. How does the public feel about Lin's tweets? I just talked to someone that has no clue who Lin is. Until people on the other side start reporting this stuff, we are still waiting for more mainstream saturation.

>>12310909

Mark it 9, Dude.

>>12310965

Pute Pepe BACK in.

That's the head scratcher.

The NG's have demonstrated that they will not touch real protesters, and will arrest rioters.

It’s a Planned Panic-demic.

It’s amazing what your own brain can do to you’re body while wrapped in fear. Keep filling people with propoganda their bound to stress their immune system into getting something. And despite the reports, covid didn’t kill ask other forms of death like a vicious monster virus. You probably got a cold.

Covid hoax

Johns Hopkins study explodes COVID death hoax; it’s re-labeling on a grand scale

https://canadafreepress.com/article/johns-hopkins-study-explodes-covid-death-hoax-its-re-labeling-on-a-grand-sc

https://archive.vn/Evla0

“only 6% of all coronavirus deaths were completely due to the coronavirus alone” cdc quietly reports

https://www.thegatewaypundit.com/2020/08/shock-report-week-cdc-quietly-updated-covid-19-numbers-9210-americans-died-covid-19-alone-rest-serious-illnesses/

https://archive.vn/JZNnm

But 3 million usa covid deaths in 2020!

https://archive.vn/j0V2g

Death by lightning, I mean covid.

https://archive.vn/dNWm6

Swedish death toll + change in death rates images

https://i.maga.host/fn9Vvql.png

https://i.maga.host/I2nvJgu.png America numbers

https://i.maga.host/ZtiGDth.png

No need covid gone (If it ever actually existed to begin with) https://www.lifesitenews.com/news/former-pfizer-vp-no-need-for-vaccines-the-pandemic-is-effectively-over

https://archive.vn/i8kNw

4.Antibodies wont last long enough? Antibodies last weeks. https://www.miamiherald.com/news/coronavirus/article244087867.html

https://archive.vn/YjUob

Antibodies?

28 days later:

https://www.outlookindia.com/website/story/world-news-moderna-vaccine-helps-antibodies-stay-active-for-90-days-reports/366157

https://archive.vn/09alU

Heard immunity unethical?! Johnson and johnson pause trials (unexplained illness)

https://www.infowars.com/posts/johnson-johnson-pauses-late-stage-covid-19-vaccine-trial-after-volunteer-becomes-sick/

https://archive.vn/WStO1

Who changes definition of herd immunity to mean vaccines

https://i.maga.host/2lIJ3Zq.png

Antibody passports? Pandemic expected for at least another year

https://worldisraelnews.com/israel-announces-green-passports-for-covid-19-recoverees-pandemic-expected-for-at-least-another-year/

https://archive.vn/V4k54

Death numbers would be so bad if medicinal people weren’t purposefully storing the deaths by killing the elderly “covid” patients. Euthanasia https://www.thesun.co.uk/news/12100515/care-homes-accused-sedatives-coronavirus-die-quickly/

https://archive.vn/27LqA

Where is the isolated virus?

https://www.lewrockwell.com/2020/12/jon-rappoport/the-sars-cov-2-virus-was-never-proved-to-exist/

https://archive.vn/WWKP2

Why sell out? Pfizer ceo sells most shares say vaccine launch.

https://financialpost.com/financial-times/why-the-pfizer-ceo-selling-62-of-his-stock-the-same-day-as-the-vaccine-announcement-looks-bad

https://archive.vn/nJzgJ

And Moderna too

https://www.bnnbloomberg.ca/moderna-chief-sells-more-shares-ahead-of-urgent-vaccine-filing-1.1526465

https://archive.vn/QXwaq

Jack Benny: Remain United.

hold the line, frens

>>12310904

>Lin wood hasn't said anything we haven't heard before. Not sure what the big revelation is here.

The info has to be slowly fed to the public, otherwise it will be rejected.

>>12310958

Anonymous ID: 5a98bb Jan. 4, 2021, 9:01 a.m. No.12310978 🗄️.is 🔗kun >>1002

>>12310924

Worldwide the number of missing reaches near 8 million annually, over 90% of which are women and children.

Even if 1% of those are victims of human trafficking, that's 220 a day that are sold into human trafficking rings.

That's a real fucking problem.

>>12310890

Hmm.

You change the res on this?

Anonymous ID: 252c00 Jan. 4, 2021, 9:01 a.m. No.12310982 🗄️.is 🔗kun >>1014

Are you involved with the blackmail scheme?

Anonymous ID: cb893e Jan. 4, 2021, 9:01 a.m. No.12310983 🗄️.is 🔗kun >>1087

>>12310973

Anonymous ID: 9cb40c Jan. 4, 2021, 9:01 a.m. No.12310984 🗄️.is 🔗kun >>0993

>>12310939

CJ Truth from twitter.

https://twitter.com/cjtruth/

>>12310933

I'll tell you what.

DON'T tell me to stop typing

and I won't tell you to FUCK OFF!

Howbowdah dickwad?!

In MY PART of this board,

the FIRST AMENDMENT rides

HIGH and LOUD.

Notables Are Not Endorsements

#15715

>>12310914 Bobby Piton insinuating a fake MSM hit piece coming out on him

>>12310905, >>12310924 John Cardillo is unhinged because of Lin Wood

>>12310973 It’s a Planned Panic-demic.`

>>12310921 pf

Anonymous ID: 3bb08e Jan. 4, 2021, 9:02 a.m. No.12310990 🗄️.is 🔗kun >>1034

>>12310965

there are no autists

and only a few anons

Thank You Baker!

Anonymous ID: a29ff6 Jan. 4, 2021, 9:02 a.m. No.12310992 🗄️.is 🔗kun >>1003

>>12310969

>I just talked to someone that has no clue who Lin is

And it's YOUR JOB to inform them

smdh

Anonymous ID: ba7d7e Jan. 4, 2021, 9:02 a.m. No.12310993 🗄️.is 🔗kun >>1008

>>12310984

>https://twitter.com/cjtruth/

oh, ok. they suspended now

>>12310968

I've seen no video of anyone shooting a kid.

>>12310709 (lb)

>>12310761 (lb)

On his third low pass, wtf fuck is up here

>>12310980

Anonymous ID: 4b1a9a Jan. 4, 2021, 9:03 a.m. No.12310997 🗄️.is 🔗kun >>1053

Are you retarded?

Anonymous ID: 18728d Jan. 4, 2021, 9:03 a.m. No.12310998 🗄️.is 🔗kun >>1082

A famous defamation lawyer wouldn’t say shit unless he can fully back it. The slow drip is starting to flow faster.

>>12310889

Kek!

ThanQ Baker!

Lucian Lincoln "Lin" Wood Jr.

https://na.leagueoflegends.com/en-us/champions/lucian/

Lucian, a Sentinel of Light, is a grim hunter of undying spirits, pursuing them relentlessly….

99.9% of humanity was assimilated into a hivemind three months ago.

No one really noticed.

Only now, the 0.01% are starting to put the pieces together

>>12310978

>>12310992

Can't inform people that don't want to listen. I'm sure the plan has something in store for those folks, too, right? Anon does his part; trust me.

Georgia Sec. of State discusses phone call with Trump about election results l GMA

“For the last two months, we’ve been fighting a rumor whack-a-mole. It was pretty obvious very early on that we debunked every one of those theories, but President Trump continues to believe them.” “Everything we’ve done for the last 12 months follows the constitution of the state of Georgia, follows the United States Constitution, follows state law.”

My local news at noon just opened with the tape of Trump, describing it as him "begging Raffensperger to change election results."

it's been a while.

Shadow strike.

A @usairforce

F-15E Strike Eagle prepares to continue its mission after refueling from a KC-135 Stratotanker over Southwest Asia.

https://twitter.com/DeptofDefense/status/1346139332969525249

>>12310993

Suspended CJ a couple weeks ago on Twitter. But he is still active on Gab and Parler

>>12310980

https://twitter.com/DeptofDefense/status/1346139332969525249

Anonymous ID: 50fd09 Jan. 4, 2021, 9:04 a.m. No.12311011 🗄️.is 🔗kun >>1169

> by 10 former Pentagon chiefs

>>12310969

Many I talk to know shit's fucked up, but just don't think anything will be done about it.

Blackpills have never been more popular.

So, while it's nice to see Lin and others putting it out on the line, it's basically reached the point where some action needs to take place in order to get the redpills flowing again.

>>12310848

mind your Qs & Ps,

soli luna,

rule of two,

>>12310982

Nope, but where is the physical evidence?

Anonymous ID: 252c00 Jan. 4, 2021, 9:04 a.m. No.12311015 🗄️.is 🔗kun >>1026

To you fuckers that hurt the innocent for personal gain. Mother fuckers like me are out here waiting for the proof.

>>12310967

-=

1

2

3

Anonymous ID: 42e15f Jan. 4, 2021, 9:04 a.m. No.12311018 🗄️.is 🔗kun >>1484

All assets deployed.

Lin has really struck a nerve. Do you midwits really think you will be able to change the narrative here?

KEK

Meanwhile in CA…

https://twitter.com/washingtonpost/status/1346069136519159814

R10153 at a Coastal Station close to Cherry Point. Two more 'X' C-30J flights out of Dyess.

>>12310920

>They showed their theft in full view, but they are all so compromised, that even full evidence is not enough to force a narrative change.

Anonymous ID: 1a7844 Jan. 4, 2021, 9:04 a.m. No.12311023 🗄️.is 🔗kun >>1038

>>12310906

Go deeper with those thoughts, anon. What does that tell you?

>>12310939

No idea. I thought it was maybe the nickname for Grant Stinchfield, but he never mentioned '17:17' being a notable.

Anonymous ID: f56d94 Jan. 4, 2021, 9:05 a.m. No.12311025 🗄️.is 🔗kun >>1141

>>12310976

>slowly fed

That's nice but 1/20 is right around the corner.

>>12311015

>Mother fuckers like me are out here waiting for the proof.

mofos like you are just fucking DUMB.

Yeah, NBC, don't be writing that "living" part of these traitors in stone.

>>12310904

It looks like a tangled shit pile of all of the above. If it's on tape it has the same effect no matter how it got there. Q said some were forced into bed with evil and that others were already there.

Thats because…

ITS AGAINST US LAW TO POST VIOLENCE AGAINST CHILDREN

Fuckstick

Use your brain.

Anonymous ID: 949102 Jan. 4, 2021, 9:05 a.m. No.12311031 🗄️.is 🔗kun >>1051

>>12311005

Yeah they are all over that section of the tape. Desperate. And why? Do they think he isnt actually going anywhere? Pics related.

>>12310914

He's a dumbass for even talking to them.

>>12310990

Anonymous ID: 349a29 Jan. 4, 2021, 9:05 a.m. No.12311035 🗄️.is 🔗kun >>1066

>>12311004

> “Everything we’ve done for the last 12 months follows the constitution of the state of Georgia, follows the United States Constitution, follows state law.”

lying mofo!

>>12310946

Leg man!

National Guard will be there at the imagnary Biden inauguration also.

Soon, thousands of National Guard members will descend upon Washington, D.C. to begin preparing to support the 59th presidential inauguration of President-Elect Joe Biden.

So far, Army and Air Guard commands from nearly 30 states have pledged to support what has become a huge tradition for the citizen soldiers.

https://www.military.com/daily-news/2021/01/02/thousands-of-national-guard-troops-prepare-support-bidens-inauguration.html

>>12311023

>What does that tell you? >>12311022

Just like the deep state is taking full advantage of COVID-19, /our guys/ should do the same.

HINT: Check Q's first post ever and think what is very easy to do now compared to pre COVID-19 world.

Anonymous ID: 5a98bb Jan. 4, 2021, 9:06 a.m. No.12311040 🗄️.is 🔗kun >>1094

>>12310979

here have the whole thing

Some of this is less than urgent

I want it down though, for the record

>>12309227 pb

Well that's a good thing

F - U to the Deep State.

Now all the Clinton emails and the rest that has been disclosed can be perfectly valid journalistic FREEDOM OF SPEECH with documentation.

and not some "Stolen in the Night" forgeries

Screw you Hillary, if you're even still alive

>>12304558 pb

"good cia officer,

good for whom, for Britain?

Sounds like an oxymoron

Also, SO THEY ADMIT THEY'RE in the secret agent business.

Is that why the FF's have to create an enemy?

>>12304589 pb

just looking at it this morning checking it again

STAGED SHOT

Those severed beams adroitly placed next to the human figures in the foreground

2 of them only

Are meant to suggest Themite / Thermate which was pushed by the controlled "Truth movement"

Could be even a shoop job ith the foreground.

Thermite / Thermate isn't the answer and that's why it's pushed so hard.

They started with Thermite; and when that wa show to be a DUD - can't explain the forensics; then they moved to Thermate, hopeing peeps would be bamboozled and agree with the sold out "engineers" that Thermate could explain

I hope they have to give back ten times the suffering they created

But do Psychopaths suffer?

They need to be outed publicly. No more "We won't tell"

"think of the families"

Now it's not about the families of thevictims who WOULD want to know the truth

ITS ABOUT THE FAMILIES OF THE PERPS

"PLEASE DON'T TELL, WHY MAKE OUR FAMILIES SUFFER bOO HOO

AND THAT S THE WHOLE BUSINSESS OF "let them retire with grace, have a noble funeral"

FUCK THAT

they need to be outed

Thank-yous to Lin S. for understanding who the real victims; and who fights for the real victims and not for the "family members" of the PERPS

BOO HOO

Seems like something like that would have leaked at some point, especially dealing with celebrities, politicians, etc.

aliens..hehe

Anonymous ID: aee2a0 Jan. 4, 2021, 9:06 a.m. No.12311044 🗄️.is 🔗kun >>1074

I’ve seen no evidence that you bothered to do any reading of the evidence he posted nor have you gotten off your lazy ass and did any research or critical thinking

Fucking lazy ass retard is what you are

Anonymous ID: a1b27b Jan. 4, 2021, 9:06 a.m. No.12311045 🗄️.is 🔗kun >>1209

>>12310964

Didn't Q drop a post of a tall guy in Hong Kong, alluding to children?

Same guy who was wearing red shoes in another pic Q dropped?

Twelve O'Clock High

-----—-***

"Criminal election tampering." kek

>>12310997

No. I can get better info on a Google search.

Anonymous ID: 9eaf72 Jan. 4, 2021, 9:07 a.m. No.12311054 🗄️.is 🔗kun >>1068

Bowser needs to beware what she wishes for. She might not get the NG deployment she wants.

A physics lesson on the MODES of heat transfer and why all modes obey the same basic principles, such as heat flowing from hot to cold only.

Also discussed is the strange situation climate science academia finds itself in today, with its believing in and active support of total pseudoscience.

>>12311043

!!!

Cardillo:DONT LOOK HERE, LOOK THERE

Ultra stealth MAGA Patriots…

Stealth drones that the government developed don't even know are in the MAGA Patriots hands… Why because their fathers left this technology for urban warfare.

>>12311037

the NG will be there to restore law & order and protect the POTUS. Donald J. Trump.

Can we start stacking bodies yet? Asking for a nation…

>>12311019

Death rate inflated much. Kek

Anonymous ID: 65da4c Jan. 4, 2021, 9:08 a.m. No.12311064 🗄️.is 🔗kun >>1078

>>12311004

Last two months, we've been fighting the rumor of Whack a Mole?

Awww, don't you know who the mole is?

Not sure who RATTED you out RATTBURGER?

Could have picked a better Zoom Background that one is kind of CHEESEY. Pillows look like Rabbits…

>>12310979

https://breakthematrix.com/blog/breaking-vice-video-shows-christchurch-shooting-victim-checking-facebook-status-watch/

>>12311035

Thinking..he's too far gone now..he has to stick to his story. He already knows it doesn't matter for him either way..he goes down..nothing can stop what the future holds for him in Gitmo.

>>12311043

>>12311054

They were going to be there anyway, just not for her.

Anonymous ID: 1ed846 Jan. 4, 2021, 9:08 a.m. No.12311069 🗄️.is 🔗kun >>1199

Biden Promises Nationwide Mask Mandate And Womandate

https://twitter.com/TheBabylonBee/status/1346131807985692674

Anonymous ID: 286c63 Jan. 4, 2021, 9:08 a.m. No.12311072 🗄️.is 🔗kun >>1176

Fake news is spewing the narrative that what the R Senators and others are doing, those who will dispute the electoral count, is UNDEMOCRATIC.

They don't ever say that what they are doing is UNCONSITUTIONAL…

>>12311044

The normies do not have time for that. They need physical proof shown to them. Where is it? not just some creepy pictures that insinuate something.

-*----–

>>12311064

something something hoisted… petard…

>>12310941

Amen and Awoman anon

Moving the Overton window on COVID?

Cheap hair lice drug may cut risk of COVID-19 death by 80 percent: study

https://nypost.com/2021/01/04/hair-lice-drug-may-cut-risk-of-covid-19-death-by-80-percent/

Why do the old timers call the NG the ‘pappy shooters’? What does that mean??

Are Dems trying to have to NG hurt or kill protesters??

Wtf..

>>12310998

or, he knows exactly how much he can say and still stay out of court.

>>12311037

>https://www.Military.com

https://who.is/whois/military.com

CSC CORPORATE DOMAINS, INC.

ALL (DISINFO) ASSETS DEPLOYED

>>12310914

Bobby Piton

interdasting fact….

pi·ton

/ˈpētän/

noun

a peg or spike driven into a rock or crack to support a climber or a rope.

Movie

Bobby is a 2006 American drama film written and directed by Emilio Estevez, and starring an ensemble cast featuring Harry Belafonte, Joy Bryant, Nick Cannon, Laurence Fishburne, Spencer Garrett, Helen Hunt, Anthony Hopkins, Ashton Kutcher, Shia LaBeouf, Lindsay Lohan, William H. Macy, Demi Moore, Martin Sheen, Christian Slater, Sharon Stone, Freddy Rodriguez, Heather Graham, Elijah Wood and Estevez himself. The screenplay is a fictionalized account of the hours leading up to the June 5, 1968, shooting of U.S. Senator Robert F. Kennedy in the kitchen of the Ambassador Hotel in Los Angeles following his win of the 1968 Democratic presidential primary in California

Anonymous ID: f5d86c Jan. 4, 2021, 9:09 a.m. No.12311086 🗄️.is 🔗kun >>1099

>>12311019

Here we go.

Which round of COVID are we on now?

3rd?

4th?

California cocksuckers!

>>12310983

Eli might want to back down before it’s too late

Anonymous ID: e34828 Jan. 4, 2021, 9:09 a.m. No.12311088 🗄️.is 🔗kun >>1105

>>12311043

Come on man, I'm losing a lot of blood over here

https://twitter.com/ScottAdamsSays/status/1346093264642818053?s=20

-*---

i due no

>>12311081

>Are Dems trying to have to NG hurt or kill protesters??

Are Dems trying to have the NG hurt or kill protesters??

>>12310814 LB

There’s a difference between stupid and ignorant. There are all levels here. Perhaps YOU need to read up on definitions of “chan” and “kun.” If you are so wise, you should be educating the others. Cussing them out is only causing division.

They want us divided.

Anonymous ID: 7b1d05 Jan. 4, 2021, 9:10 a.m. No.12311094 🗄️.is 🔗kun >>1150

>>12311040

I was up that night on 8chan.

Posted photo of the graffitied rifle (pointed out the little girl's name)

I don't know where I stand with the whole thing now, after having watched many, many vids.

>>12310789 (last bread)

NOTABLE

>The 1973 Home Rule Act, which granted the District limited autonomous authority, contains provisions for the “emergency control of police” via a federal takeover of the D.C. police.

To invoke that act, the president would have to determine that “special conditions of an emergency nature exist which require the use of the Metropolitan Police force for federal purposes.” The takeover may last up to 48 hours and may be extended with approval of the members of Congress that oversee District affairs, the act states.

https://www.washingtonpost.com/local/public-safety/dc-police-takeover-george-floyd/2020/06/02/856a9744-a4da-11ea-bb20-ebf0921f3bbd_story.html

HINT HINT Boss

Anonymous ID: 47cf17 Jan. 4, 2021, 9:10 a.m. No.12311097 🗄️.is 🔗kun >>1118

>>12311041

Congress Approves Rules Regulating Jan. 6 Electoral Vote Count

January 4, 2021

The House of Representatives and the Senate on Sunday adopted rules that outline how the counting of Electoral College votes will take place on Jan. 6.

The rules were passed without recorded votes. Instead, a voice vote was used in both chambers.

The guidance, introduced by Senate Majority Leader Mitch McConnell (R-Ky.), says the chambers will meet in a joint session on Jan. 6 presided over by Vice President Mike Pence.

Pence, as president of the Senate, will open “all the certificates and papers purporting to be certificates of the electoral votes,” the rules state, a nod to how seven states sent so-called competing electors, or certificates for both Democratic presidential nominee Joe Biden and President Donald Trump, to Washington.

The certificates and papers will be opened, presented, and acted upon in alphabetical order, starting with Alabama.

This is when dozens of Republicans—50 representatives and 12 senators, according to an Epoch Times tally—are planning to object to some certificates, alleging election irregularities including voter fraud and failure to follow state election laws.

That will trigger a withdrawal from the joint session and a two-hour debate, followed by votes in each chamber. Only with a majority vote from both the House and the Senate would a challenge be upheld, which even supporters find unlikely, considering Democrats who control the House and Senate Republican leadership, including McConnell, have expressed disapproval with the plan to object.

House Speaker Nancy Pelosi (D-Calif.) in a letter to colleagues on Sunday noted that objections can happen but said, at the end of the day, Biden “will be officially declared the next president.”

“On Monday, we will have a clearer picture of how many state votes will be subject to an objection. Our choice is not to use the forum to debate the presidency of Donald Trump,” she added.

Reps. Ron Estes (R-Kan.), Tracey Mann (R-Kan.), and Jacob LaTurner (R-Kan.) said Sunday they will join in the objections, saying in a statement that several states are “facing serious allegations of voter fraud and violations of their own state law.”

“This action is not taken lightly and comes after extensive study and research. Kansans deserve to know that all legal, and only legal, votes were counted. We hope our actions begin to restore the confidence of tens of millions of our fellow Americans that feel their sacred right to vote is under attack,” they added.

Reps. Jim Jordan (R-Ohio) and Richard Hudson (R-N.C.) also announced Sunday they’ll object.

But seven Republican representatives, including several strong Trump supporters, said they will not join in the effort, and denounced the move.

“Of the six states as to which questions have been raised, five have legislatures that are controlled by Republicans, and they all have the power to send a new slate of electoral votes to Congress if they deem such action appropriate under state law. Unless that happens between now and Jan. 6, 2021, Congress will have no authority to influence the outcome of the 2020 presidential election,” the group wrote in a statement.

“To take action otherwise—that is, to unconstitutionally insert Congress into the center of the presidential election process—would amount to stealing power from the people and the states. It would, in effect, replace the Electoral College with Congress, and in so doing strengthen the efforts of those on the left who are determined to eliminate it or render it irrelevant.”

The weekend saw a flurry of action, with 11 senators following Sen. Josh Hawley (R-Mo.) in announcing they’d join in the objections unless Congress appoints a commission to examine alleged election irregularities. The idea is modeled on the panel formed in 1877 amid a contested election.

Hawley’s Dec. 30 announcement triggered a number of House members to announce their intention to object. The number planning to do so has more than doubled since then.

A segment of Republicans are focusing on Pence’s role in the proceedings. They sued the vice president and asked a court to rule he has the “exclusive authority” to decide between dueling electors.

A judge dismissed the case and an appeals court rejected an appeal.

Pence had asked the court to dismiss the suit but said through a spokesman on Saturday that he supports efforts to challenge electoral votes.

“Vice President Pence shares the concerns of millions of Americans about voter fraud and irregularities in the last election,” Pence’s chief of staff, Marc Short, said in the statement sent to media outlets.

https://www.theepochtimes.com/congress-approves-rules-regulating-jan-6-electoral-vote-count_3642381.html?utm_source=news&utm_medium=email&utm_campaign=breaking-2021-01-04-2

>>12311086

The new strain is called covid 5… thousand.

>>12310622 lb

>>12310921 lb

OK, I found it

The Blacklist Button

https://8kun.top/qresearch/res/12117594.html#q12118644

This is for eliminating images you never want to see again.

(I wonders how you get them back if you make a mistake - oh well)

Once you take the red pill, it's almost like you're living in a completely different world.

snuff films and child pornography are against the law, if you searched out the evidence mentioned, you would have had to use research tools beyond this board to see that.

P.S. - don't try it, you seem too stupid to realize once on your computer you are now accessory to a crime.

Anonymous ID: a31a04 Jan. 4, 2021, 9:10 a.m. No.12311103 🗄️.is 🔗kun >>1129

tyb

I like this pic better than the usual

masked Asian chicks .

>>12311088

So if I do travel it'll be with this story:

"I have a self published site and I am 'working' the 'poltical protest' so you have no authoritae to do anything more than show me your cheery eyes and wish me well in my travels or assist me should I need you too, sir or maddam or whatever you prefer to be called."

if you book in Md they might say '10 daze at the BaccchhhQue of the Buzss' to the detention quarantine facilitattatae unless you have an authorizzed by my pension funds test for the phake-en-gay virus.

that even if you get the test it means nothing except it enriches those who give it or provide it.

anyway, so ya, if you stay in PA or MD and even NJ you need to be worried about hassles. (wait, I didn't find out about NJ

only VA seems hassle free but they still have the brain-dead 'you must wear a mask inside' requirement.

if you are on business they give you a pass in MD and PA but not sure about NJ.

the point of the 'free commerce' clause is so that we don't have to deal with this.

as it is I have to buy a card to use the subway and give them money up front . . .

or to park and face the question 'mame, where is your test result'.

I have a quilting website and I'm doing business research on patriotic quilt designs so I'm on business travell and you can't harm me.

but they don't want to harm me.

all the quarantine and test requirements are uncivil hazing.

I run a fishing website and I'm doing reserach on trout at the Reflecting Pool because I heard it's going to be the national surfing tidal pool slash national trout pond when renovations are done and toxic waste sites removed from local buildings nearby and in the view of better buildings, needing to have expanded basements like they would do in the old world (just build it into a vault and build on top of it.

)

we could do a recreation of the Pallantine Hill circa 300 AD . . . complete with a hipodrome and a surfers pool . . .

and a 'Graftaneum': with monuments to various grafts, grifts, and shameful appropriation shinanagins . . .

is it a Griftnaeum of a Graftnaeum?

Naeum, niaum? you can call the whole thing off but the people still want fair elections.

Ir timeline

Current mood.

wth no friends.

Anonymous ID: 022f3c Jan. 4, 2021, 9:11 a.m. No.12311116 🗄️.is 🔗kun >>1124

Rush not back on the air today. Hope he is still winning the battle.

>>12311060

MAGA Patriots: General Flynn is a pile of shit. Ask him about the 500 thousand Christian people killed under his watch….. Fuck you general Flynn.

>>12311097

If the entire frame of the WTC's was steel - then we should have seen it melt into a pile by the official story, not collapse into dust.

Anonymous ID: 4b1a9a Jan. 4, 2021, 9:11 a.m. No.12311120 🗄️.is 🔗kun >>1137

>>12311074

WHO CARES ABOUT THE NORMIES ANYMORE??

They will either ride the wave or drowned.

Release it all!

Check’d

Martial Law it is!

-*--

>>12311116

Aye.

>worldview

fify

Precipice

–Press Appease

—Press app ice…(!)

>>12311004

High ground.

>11:11:11

>12311111

holeymoley anon, chkt!

Anonymous ID: f5d86c Jan. 4, 2021, 9:12 a.m. No.12311129 🗄️.is 🔗kun >>1147

>>12311103

Killer looks like what's his name

from what's that movie.

Axe through the door, face peeking in,

what was it he said again?

"Heeeere's Johnny."

--***//

Notables Are Not Endorsements

#15715

>>12310914 Bobby Piton insinuating a fake MSM hit piece coming out on him

>>12310905, >>12310924 John Cardillo is unhinged because of Lin Wood

>>12310973 It’s a Planned Panic-demic.`

>>12311007, >>12311010 Shadow strike.

>>12311080 Cheap hair lice drug may cut risk of COVID-19 death by 80 percent: study

>>12311089 How the fake news industry manufactures hoaxes

>>12311096 The 1973 Home Rule Act

>>12311098 Congress Approves Rules Regulating Jan. 6 Electoral Vote Count

>>12310921, >>12311021 pf

anons, wtf do you park if you're headed to DC from NE?

No, anon does not want to meet you.

Raffensberger thinks by saying "That's not true" or "We got different numbers" without showing proof, will make this all go away.

>>12310903

this partly for pushing them into the satanist matriarchal societal model

Anonymous ID: e34828 Jan. 4, 2021, 9:13 a.m. No.12311135 🗄️.is 🔗kun >>1164

And trying to tell enlighten others about all of it is the craziest mindfuck ever.

>>12311081

They may try this old trick again. FF incoming, blame the NG. They will not succeed if they attempt

https://en.m.wikipedia.org/wiki/Kent_State_shootings

>>12311120

Normies comply. Just a matter of who’s in charge.

Anonymous ID: a29ff6 Jan. 4, 2021, 9:13 a.m. No.12311138 🗄️.is 🔗kun >>1159

oh fuck you, faggot

He's a fucking General. A military man. People die. You are a fucking homo.

>>12311096

>>12310742

>>12310704

"I was looking for info on her ability to shut down travel in DC, and I came across an article that mentioned a little known ACT that allows POTUS to force her to hand over control of DC police. He has 48 hours after doing it to notify Congress."

>>12311118

>>12311025

>1/20 is right around the corner

Q111: The complete picture would put 99% of Americans (the World) in a hospital.

Q142: The truth would put 99% of people in the hospital. It must be controlled.

mike pence wife owned by chyna?

>>12311126

Lin Wood Fireside Chat 4, Is Jeffrey Epstein Alive? Can Vice President Pence Be Trusted? + 100%

https://youtu.be/M27I3k-AV6c

Anonymous ID: 666a80 Jan. 4, 2021, 9:14 a.m. No.12311145 🗄️.is 🔗kun >>1165

Anonymous ID: f08cb6 Jan. 4, 2021, 9:14 a.m. No.12311146 🗄️.is 🔗kun >>1165

>>12311133

Why not? It has worked for the Uni-Party traitors for decades!

Anonymous ID: a31a04 Jan. 4, 2021, 9:14 a.m. No.12311147 🗄️.is 🔗kun >>1241

>>12311129

red rum!

Anonymous ID: a29ff6 Jan. 4, 2021, 9:14 a.m. No.12311148 🗄️.is 🔗kun >>1155

ever use a map?

gonna need more than your looks this time.

spin spin spin!

Anonymous ID: 5a98bb Jan. 4, 2021, 9:14 a.m. No.12311150 🗄️.is 🔗kun >>1237

>>12311094

a 17yr old New Zealand kid is in jail for sharing the exact video I posted. He might be 18 now, since it's been a while, he may even be 19, but he's still in jail.

Anonymous ID: 4a8786 Jan. 4, 2021, 9:14 a.m. No.12311151 🗄️.is 🔗kun >>1180

New rules on removal of illegal online content could help in battle against child pornography

smoke screen for censorship

Ottawa drafting legislation to require removal from websites within 24 hours. A December 2019 mandate letter sent to Guilbeault by Prime Minister Justin Trudeau called for his department to create new regulations that would require social media platforms and adult websites operating in Canada to remove illegal content within 24 hours or face "significant penalties." The heritage minister says the coming regulations will apply to any company operating in Canada, regardless of where they are registered, where their head offices are located or where their servers exist.

https://www.cbc.ca/news/canada/manitoba/canada-illegal-online-content-child-porn-1.5847695

The letter

Create new regulations for social media platforms, starting with a requirement that all platforms remove illegal content, including hate speech, within 24 hours or face significant penalties. This should include other online harms such as radicalization, incitement to violence, exploitation of children, or creation or distribution of terrorist propaganda.

https://pm.gc.ca/en/mandate-letters/2019/12/13/minister-canadian-heritage-mandate-letter

Anonymous ID: 518715 Jan. 4, 2021, 9:14 a.m. No.12311152 🗄️.is 🔗kun >>1172

Those that know, don't sleep well if at all. The version of reality we are in is fluxing due to a time war effecting movie outcomes.

Start tracking your own list of mandela effects

booby, you lost the board, faggot.

Anonymous ID: 1ed846 Jan. 4, 2021, 9:14 a.m. No.12311154 🗄️.is 🔗kun >>1270

>>12311148

useless asshole filter.

Anonymous ID: a31a04 Jan. 4, 2021, 9:15 a.m. No.12311156 🗄️.is 🔗kun >>1163

do you have a place to stay? park at hotel and i would call ahead to let them know you're almost there.

Chkd

>>12310381 pb

^^^THIS

Until LLCool Wood drops the sauce, all we got is dry-ass pasta.

>>12311138

Shut your Chinese cocksuker asshole mouth@~

Just so everyone is aware, Mayor BOWSER has no authority over DC NG. That power belongs to President Trump only due to DC's unique status. So this is just worthless piece of paper which has no authority to back it up.

"Trump has free rein in D.C. because of the city’s unique constitutional status. We only have “home rule,” granted by Congress, not sovereignty; we have no governor, so the D.C. National Guard answers to Trump, not to Mayor Muriel E. Bowser

https://www.washingtonpost.com/outlook/2020/06/05/dc-is-one-city-where-trump-can-indulge-his-police-military-fantasies/

nice digits

>>12311133

Anon would be ashamed if POTUS was even a tiny fraction as upset with me as he was with Raffensturdburgler. And he was being gracious on that call. kek

>>12311156

nah. commuting.

Anonymous ID: a29ff6 Jan. 4, 2021, 9:15 a.m. No.12311164 🗄️.is 🔗kun >>1187

>>12311135

yeah? try being anon in Nov 2017.

Anonymous ID: 666a80 Jan. 4, 2021, 9:15 a.m. No.12311165 🗄️.is 🔗kun >>1179

>>12311145

>>12311146

never happened. But thank God he dusted shitloads of muslims!!

Welcome!

>>12311011

fkn svd

Exaclty.

The bots are here to make him seem insane.

LOL. that will never work.

>Once you take the red pill, it's almost like you're living in a completely different world.

>>12311152

I lose track of at least one whole day a week. whoosh

Anonymous ID: a5b386 Jan. 4, 2021, 9:16 a.m. No.12311173 🗄️.is 🔗kun >>1459

>>12311108

Anonymous ID: e306e9 Jan. 4, 2021, 9:16 a.m. No.12311174 🗄️.is 🔗kun >>1188

Find a train station as close as you wanna go, park there, ride the train into DC.

>>12311098

So it seems like a President Biden to me.

Anonymous ID: 8bd541 Jan. 4, 2021, 9:16 a.m. No.12311176 🗄️.is 🔗kun >>1246

>>12311072

They want everyone to believe this country is a democracy..which is why they use words like undemocratic.

You will never catch them uttering the word REPUBLIC.. which is what this country really is..

Not a memer..but distinguishing the differences here would be an important meme.

Anonymous ID: 4dce7a Jan. 4, 2021, 9:16 a.m. No.12311177 🗄️.is 🔗kun >>1218

She is on prescription psychotropics. In a big way.

Those drugs block you from the Holy Spirit.

People who take Trunalimunumaprzure(tm) should not be the position of making decisions for the well-being of others. The streets of DC are not like your home town.

Her signature almost even looks like she is trying to copy BHO's. kek

Anonymous ID: 2234b7 Jan. 4, 2021, 9:16 a.m. No.12311179 🗄️.is 🔗kun >>1195

>>12311165

Anonymous ID: 47cf17 Jan. 4, 2021, 9:16 a.m. No.12311180 🗄️.is 🔗kun >>1210

>>12311151

>>12311159

the little faggot is triggered! LMFAO

kek kek kek

so fucking FUNNY to see you sperg out

>>12311115

Dumbing yourself down to have relationships is truly painful. Told a long time close friend recently that I would slap the shit out of anyone who murmurs the word "covid" in my presence. He wasn't taking the hints otherwise.

Anonymous ID: e2f0c4 Jan. 4, 2021, 9:17 a.m. No.12311183 🗄️.is 🔗kun >>1203

**–

Checked

I guess its all settled then…

the problem that normies have with it, is that it's exactly what all these "crazy conspiracy theorists" ie. anons, anyone questioning the narrative, as being correct. it fucks with their cognitive dissonance.

Anonymous ID: e34828 Jan. 4, 2021, 9:17 a.m. No.12311187 🗄️.is 🔗kun >>1201

>>12311164

I was there.

Anonymous ID: 3bb08e Jan. 4, 2021, 9:17 a.m. No.12311188 🗄️.is 🔗kun >>1225

>>12311174

ain't gonny mask anon

Anonymous ID: ea3c45 Jan. 4, 2021, 9:17 a.m. No.12311189 🗄️.is 🔗kun >>1206

Father, as I walk this path that you have set before me, let me take time to thank Mother earth for allowing me to walk upon her green grasses, for brother sun who shines brightly upon me, for the 4 brothers of the winds who send the sweet scent of flowers to me, and for the gift of sister moon who shines to guide me through the night.

WA DO

Notables Are Not Endorsements

#15715

>>12310914 Bobby Piton insinuating a fake MSM hit piece coming out on him

>>12310905, >>12310924 John Cardillo is unhinged because of Lin Wood

>>12310973 It’s a Planned Panic-demic.`

>>12311007, >>12311010 Shadow strike.

>>12311080 Cheap hair lice drug may cut risk of COVID-19 death by 80 percent: study

>>12311089 How the fake news industry manufactures hoaxes

>>12311096, >>12311139 The 1973 Home Rule Act

>>12311098 Congress Approves Rules Regulating Jan. 6 Electoral Vote Count

>>12311160 Mayor BOWSER has no authority over DC NG. That power belongs to President Trump only due to DC's unique status.

>>12310921, >>12311021 pf

>>12311108

fuckin A.

https://twitter.com/Not_the_Bee/status/1345512562897661953

//-*--

So years from now will they make a Cannonball run type movie about all the people who are road tripping to WAshington DC tomorrow night and how just make it in time to see . . .

well only some people know that, I sure don't.

If I can't get there I'll send my prayers and be vigilant during it and watch it live.

>>12311179

Anonymous ID: 748849 Jan. 4, 2021, 9:17 a.m. No.12311196 🗄️.is 🔗kun >>1212

>>12311060

>>12311083

I know it might be hard for many here to accept but not all military is /ourguys/

We've seen evidence of this over and over since the digital war began.

>Vindman

>NG Whistleblower, Adam Demarco

>Mattis

>McRaven

But muh Martial law. But muh military tribunals!

BOT IS MAD

-////-

>>12311069

>https://twitter.com/TheBabylonBee/status/1346131807985692674

>Mandate And Womandate

>>12310947

They don't have to respond to this at all because President Trump controls DC National Guard, not the Mayor. I hope Major General Walker knows the law too.

https://www.washingtonpost.com/outlook/2020/06/05/dc-is-one-city-where-trump-can-indulge-his-police-military-fantasies/

Anonymous ID: a29ff6 Jan. 4, 2021, 9:18 a.m. No.12311201 🗄️.is 🔗kun >>1234

>>12311187

ok then. you must know how much EASIER it is now. People are catching on.

As Q said, it will happen FAST.

There were 18 attempted calls from the White House to GA secretary of state's office, sources say

https://edition.cnn.com/2021/01/04/politics/trump-brad-raffensperger-calls-georgia/index.html

>>12311183

Guise I have a hunch:

MSM and all the talking heads

are missing the whole point of

POTUS 45 Trump

allowing himself to be recorded

telling GA

he only needs

11,780 votes

to be SPECIFIC.'

POTUS is alerting

to all who are paying attention

THEY ALREADY HAVE IT ALL

allowing GA fu*ks traitors

THEM

to be the ones on the phone being recorded

to be aired worldwide as KNOWINGLY lying.

Trump is all COMMS

as to what is up

and what is about to go down

A'ND WHAT THEY KNOW'

It is all a Q troll all day long and they bite every time.

11,780 adds up to 17 which is Q COMMS'

BUT EVEN MORE IT IS A CALL TO DIG ???

>>12311019

>>12311189

>Mayor Bowser is requesting support by the NG for Jan. 6th.

Anon sees it just the opposite. It's to neuter them. Note: No DCNC personnel shall be armed, at no time, will DCNC personnel or assets be engaged in domestic surveillance searches, or seizures of US persons.

>>12311045

Yes and we discussed whether it was we >>12311074

Again lazy as you appear to be THERE ARE FUCKING PROOFS ALL IVER THE PLACE YOU ARE HERE

FIND THEM OR GO BACK TO NORMIEVILLE

>>12311180

LOOK and THINK guise : 'find 11.780 votes' IS A THING for us to dig on

'

now PAY ATTENATION AS we ARE TO SEE THIS

11780 IS comms

Trump is telling them and us HE KNOWS something regarding 11780

Go to Duckduckgo safe search off

Simply type in 11780 Q

'''It AUTOMATICALLY takes you to the ANSWER tab, not to the tab for All or Images or Videos or News or Maps, it just goes to the ANSWER tab. I did not ask it to or direct it to the ANSWER TAB

When there look and THINK:

https://duckduckgo.com/?q=11%2C780+Q&atb=v225-1&ia=answer

It is pointing us to a lot of topics

A DIGG SHOULD ENSUE all things 11780 Q

Anonymous ID: a29ff6 Jan. 4, 2021, 9:18 a.m. No.12311212 🗄️.is 🔗kun >>1240

>>12311196

please try to use your brain. Do you have one?

Sloppy job Mossad

Resurfaced Video Of Dems Objecting to Electoral College Votes is BRUTAL

https://rumble.com/vcfb31-resurfaced-video-of-dems-objecting-to-electoral-college-votes-is-brutal.html

@michellemalkin

"FUCK PAUL RYAN."

https://twitter.com/michellemalkin/status/1345848117900398593

Hoping POTUS uses those rally big screens for some DECLAS. It's a powerful tool. Always thought it would be good to put some screens and loudspeakers in front of protesters to show them some facts about the criminals.

>>12311177

>Her signature almost even looks like she is trying to copy BHO's. kek

Then clearly you haven’t dug far enough. Best gore dot com has normal murder shiz. If you seek the crazy shit you gotta bust into dark web territory. Hell, even on Usenet and Torrents there’s plenty of illegal F’ed up shit. I’ve unintentionally seen plenty to last a lifetime.

>>12311206

Anonymous ID: 193173 Jan. 4, 2021, 9:19 a.m. No.12311221 🗄️.is 🔗kun >>1526

the items that populate are curious indeed:

MASS

11780

Metric "Q"uintal = 1178000000

Trump, GA, WAPO, FARK.com (11070772) Dis Trukp break state and federal, adresses in SAINT JAMES, NY, Who lives at,

Covid-19 product Hillyard- HIL0016700 Q.T. information for a hard surface disinfectant that is effective,

MOVIE THEATER TIMES,

then another link for the Hillyard Covid-19 cleaner,

Allstate Insurance Ryan Dittmar, Saint James, NY,

radioation dose from X-ray scatter,

ADDRESSES in SAINT JAMES, NY

Anonymous ID: d1be3e Jan. 4, 2021, 9:19 a.m. No.12311222 🗄️.is 🔗kun >>1248

>>12311118

What’s your point? That the towers didn’t have 47 steel box columns running through the core of the structure? Or something else?

Anonymous ID: a1b27b Jan. 4, 2021, 9:19 a.m. No.12311223 🗄️.is 🔗kun >>1238

>>12311220

>>12311115

Probably ostracized myself from one of the hockey teams I play on last night at a team party… fuck em. If we are right they will have to come around sooner or later

>>12311188

wear a nice western bandanna. Pull it up, let it fall, no one much says anything.

I don't wear em myself, or any mask, just so I can yell at someone if they say something to me, but that's me. I plainly don't give a fuck for any authority save that of our Creator.

Here the deal my ATS friend

Ya my 3 day ban turn into a life ban

Your next

Please add any new one here

New _Ghost Drop on ATS

http://files.abovetopsecret.com/files/img/kl5eb8a558.png

http://files.abovetopsecret.com/files/img/bu5eb8a579.png

http://files.abovetopsecret.com/files/img/qa5eb8a5a0.PNG

http://files.abovetopsecret.com/files/img/lf5eb8a6de.PNG

http://files.abovetopsecret.com/files/img/mn5eb8a6fd.PNG

http://files.abovetopsecret.com/files/img/yf5eb8a7f7.PNG

http://files.abovetopsecret.com/files/img/zh5f68b760.png

http://files.abovetopsecret.com/files/img/or5fa0bb4b.PNG

New one Dec 12/20

http://files.abovetopsecret.com/files/img/wm5fd55bfa.PNG

New One Dec 28/2020

http://files.abovetopsecret.com/files/img/ca5feada9c.PNG

https://endchan.net/qanonresearch/res/48336.html#48510

https://endchan.net/qanonresearch/res/48336.html#49389

https://endchan.net/qanonresearch/res/49106.html#49628

https://endchan.net/qanonresearch/res/49106.html#49651

https://youtube.com/watch?v=iMhDySGyI9E

https://twitter.com/KyleHooten2/status/1346142068670922753?s=19

Looks like protestors may have replaced an American flag with the Somali flag in south Minneapolis

>>12311022

Ideo mittet illis Deus operationem erroris ut credant mendacio,

>>12310704 (pb)

re NG and DCMPD on 1/6

Find And Stay Near Veterans (milanons) AND Leave in Groups

Took my teen kids to the Inauguration in 2016. The NG AND the DCMPD completely STOOD DOWN as pantifa disrupted ALL the long lines to enter the parade route and flood the Mall. There were easily 500 - 750K of us who were prevented from entering through the few security gates. All of us MAGA families were pissed off and complaining to the PD and NG (ALL were black, BTW) and they thought it was the funniest thing ever as they openly allowed pantifa to stand in large groups blocking each of the entrances. Once we all realized what was going down after POTUS speech ended we all headed to the Metros to escape the gangs of pantifa who had torched DC the previous nights. My advice would be to find and stick with groups of Veterans/anons and leave in groups at the end of the day. If you notice lone families or small groups, take them under your wing as you are getting near the end of the day. Try to help any stragglers you may run into as the walking dead will begin to show themselves as the sun gets low.

Remember

WWG1WGA!!!

Odd place for a quake don't you think frens.

https://earthquake.usgs.gov/earthquakes/map/?currentFeatureId=us6000d5g7&extent=21.9838,-130.16602&extent=51.78144,-59.85352

Anonymous ID: 3bb08e Jan. 4, 2021, 9:20 a.m. No.12311232 🗄️.is 🔗kun >>1266

crush intensifies

Anonymous ID: 193173 Jan. 4, 2021, 9:20 a.m. No.12311233 🗄️.is 🔗kun >>1526

The very first and all other items that come up are

Q.11780: In the public sector, as opposed to the privat

Q.11780: In the public sector, as opposed to the privat

Search domain www.briefmenow.org/isc2/in-the-public-sector-as-opposed-to-the-private-sector-due-care-is-usually-determined-by-2/www.briefmenow.org/isc2/in-the-public-sector-as-opposed-to-the-private-sector-due-care-is-usually-determined-by-2/

ISC question 11780: In the public sector, as opposed to the private sector, due care is usually determined byA. Minimum standard requirements.B. Legislative

GA, Trump, Covid-19, addresses in Saint James, NY, MOVIE THEATER TIMES, radiation scatter dose info, Allstate Insurance Ryan Dittmar, Saint James, NY,

and adressess????

FOR SAINT JAMES, NY

7 Fox Point Dr.

280 7th Ave

Northern Blvd

11 Pheasant Run

7 Carmen Ln

3 Hawks Nest

139 Woodlawn

576 LongBeach Rd

41 pLANE tREE lN

A link for Broadband Internet in Saint James 11780 zip code just is in the middle???

>>12311201

For certain parts of this, yes.

There is still a lot to go through though and some of it is still hard to believe for most, even here.

Rip the veil off, I'm all for it.

Anonymous ID: 2234b7 Jan. 4, 2021, 9:20 a.m. No.12311235 🗄️.is 🔗kun >>1256

>>12311220

was a nice prayer though

Anonymous ID: 193173 Jan. 4, 2021, 9:20 a.m. No.12311236 🗄️.is 🔗kun >>1526

An address IN GEORGIA also come up???

11780 Ashwick Pl, Alphretta GA that highlights being near SCHOOLS in Fulton county.

11780 Ashwick Pl, Alpharetta, GA 30005 | 25 Photos | MLS …

Search domain www.movoto.com/alpharetta-ga/11780-ashwick-pl-alpharetta-ga-30005/pid_q0vdn69lbh/for-sale/https://www.movoto.com/alpharetta-ga/11780-ashwick-pl-alpharetta-ga-30005/pid_q0vdn69lbh/for-sale/

11780 Ashwick Pl Alpharetta, GA 30005 is located in the Fulton County School District and the nearest school is Abbotts Hill Elementary School. an ideal family neighborhood with Chattahoochee High School highly rated assigned schools. Discover more about the Alpharetta.

THEN YOU GET A LINK TO A COVID -19 HARD CLEANER

Hillyard - HIL0016700 Q.T. with a registered trademark symbol which reads:'''

Hillyard - HIL0016700 Q.T.®

Search domain b2b.hillyard.com/productdetail/index/grid/wwsa/C~11865,PL~11780,PD~HIL0016700https://b2b.hillyard.com/productdetail/index/grid/wwsa/C~11865,PL~11780,PD~HIL0016700

HIL0016700 Q.T.® Q.T. (EPA Reg # 1839-166-1658 ) has demonstrated effectiveness against viruses similar to 2019 novel coronavirus (SARS- CoV-2) on hard, non-porous surfaces. Therefore, this product can be used against SARS-CoV-2, the novel coronavirus that causes the disease COVID- 19, when used in accordance with the directions for use against Rotavirus on hard, non-porous surfaces. <br …

THEN you get MOVIE TIMES AND MOVIE THEATERS IN 11780-LOCAL SHOWTIMES

theaters near you

'THEN again :

Hillyard - HIL0082400 Q.T.® Plus

Search domain b2b.hillyard.com/productdetail/index/grid/wwsa/C~11865,PL~11780,PD~HIL0082400https://b2b.hillyard.com/productdetail/index/grid/wwsa/C~11865,PL~11780,PD~HIL0082400

Q.T. Plus is designed for use on walls,countertops,fixtures,restroom and shower rooms,and other hard surfaces where disinfectint is a must. On 7/29/20, The EPA published updated label claims on List N for QT Plus as effective against SARS-CoV-2, the virus that causes COVID-19 with a 3- minute contact time.

>>12311150

The ever-growing DS resort of tranny Jacinda.

The gun grab sealed it.

>>12311223

>>12310951

Yes, that seemed significant to me, too. By requesting, is he trying to dictate the terms of their engagement? I think I might actually prefer that they are armed and ready to defend citizens.

Anonymous ID: 748849 Jan. 4, 2021, 9:21 a.m. No.12311240 🗄️.is 🔗kun >>1267

>>12311212

Tell me why I'm wrong or just continue to not provide evidence for why I'm wrong.

Would seriously appreciate to be wrong.

>>12311147

Yup.

That's the one.

Still haven't watched that movie.

With the iconic snippets popping-up

repeatedly over the years, it seems like

I already had.

MAGA Patriots: General Flynn is a pile of shit. Ask him about the 500 thousand Christian people killed under his watch….. Fuck you general Flynn….

>Once you take the red pill, it's almost like you're living in a completely different world.

not almost. It is.

>>12311226

Anonymous ID: 4dce7a Jan. 4, 2021, 9:21 a.m. No.12311245 🗄️.is 🔗kun >>1279

Anonymous ID: ba7d7e Jan. 4, 2021, 9:21 a.m. No.12311246 🗄️.is 🔗kun >>1337

>>12311176

democracy = direct vote as individual

republic = representative vote, with the STATES as the voters.

This is why the leftists do not like the EC.

Anonymous ID: ad1cad Jan. 4, 2021, 9:21 a.m. No.12311247 🗄️.is 🔗kun >>1526

He probably said something with enough plausible deniability but also enough controversy that they would release the call if they were taping it.

Trump is a genius

>>12311222

20 years living the lie.

This is the year we take the Truth out for all to see.

Anonymous ID: 193173 Jan. 4, 2021, 9:21 a.m. No.12311249 🗄️.is 🔗kun >>1526

all should be looked at???

so much more that seems odd

all with the simple 11, 780 Q as the search:

SOME MAY BE NOTHING AT ALL OTHERS MAY BE SOMETHING????

https://clustrmaps.com/a/34q10d/

11780 Borman Dr, St. Louis, MO Public Records

Search domain clustrmaps.com/a/34q10d/https://clustrmaps.com/a/34q10d/

This address may be also written as 11780 Borman Drv, St. Louis, MO 63146.

We know about 48 companies registered at this address. These are some of the names: Nba Disciples Housing of Boise, Idaho, Inc and The Redemption Group Network. Nba Disciples Housing of Boise, Idaho, Inc is connected to this address through UCC records. Children's Hope International Foundation (licence Corporation Public Charity) and Children's Hope International/china's Children (licence Religious Organizations) are license holders registered here.. This address is #836 on the list of state addresses by the number of businesses registered there. WHOIS records associate this address with five domain names. Three registrant names found. This address may be also written as 11780 Borman Drv, St. Louis, MO 63146. 38.693957,-90.433225 are the latitude and longitude of the address location. Monthly rental prices for a two-bedroom unit in the zip code 63146 is around $1,110

qBittorrent

Wrong number of torrents with tracker problems displayed …

Search domain github.com/qbittorrent/qBittorrent/issues/11780https://github.com/qbittorrent/qBittorrent/issues/11780

Please provide the following information qBittorrent version and Operating System v4.2.1, windows 8.1 If on linux, libtorrent-rasterbar and Qt version (type here …

Blue Geri Velvet Queen Bed | GeriNavy-Q

Search domain www.meridianfurnitureusa.com/sitefiles/product-1437-11780/geri-bed-blue.htmlhttps://www.meridianfurnitureusa.com/sitefiles/product-1437-11780/geri-bed-blue.html

queen size Geri Velvet Bed in blue features soft midnight navy velvet, gold & chrome legs included, piping on headboard and footboard, contemp…

https://www.meridianfurnitureusa.com/sitefiles/product-1437-11780/geri-bed-blue.html

Weird Chinese game shit thta talks about SPELLS: https://www.op.gg/champion/cassiopeia/statistics/mid

s11 Middle Cassiopeia build guides, counters, guide, pro …

Search domain www.op.gg/champion/cassiopeia/statistics/midhttps://www.op.gg/champion/cassiopeia/statistics/mid

Cassiopeia build guides - op.gg provides builds, counters, guides, masteries, runes, skill orders, combos, pro builds and statistics by top, jungle, mid, adc, support …

>>12311229

notable

Anon advice DC Travel

For those interested, Sol Wisenberg has finally come out of the closet as the swamp rat he is. He's a calm, measured, and logical guy so his panic is hard to discern, but it's there nonetheless.

https://twitter.com/WisenbergSol

you fucking cunt KILL YOURSELF

Anonymous ID: 8bd541 Jan. 4, 2021, 9:21 a.m. No.12311254 🗄️.is 🔗kun >>1526

Anon, remember when there was an overnight watch over the vote machines in GA.. CM reported that they were picked up in trucks and taken away?? Hmm wonder who has them?.. who really has them?

AFB?

Jason Vorhees, ID: c6cd29 Jan. 4, 2021, 9:22 a.m. No.12311256 🗄️.is 🔗kun >>1358

>>12311235

not a chance, I believe th bible is a

cook book, it's not what you think

it says,

Anonymous ID: 2c08a3 Jan. 4, 2021, 9:22 a.m. No.12311258 🗄️.is 🔗kun >>1282

>>12310856 PB

Hmm…that makes you a cancer to humanity! Perhaps you could practice another way of existence!

If I were so fortunate as to cuff Ryan, I might accidentally slam him into a door frame on the way out.

I'll check out your suggested URL

Anonymous ID: 193173 Jan. 4, 2021, 9:22 a.m. No.12311261 🗄️.is 🔗kun >>1526

NO REFERENCE TO 11,780 Q, the search info, AT ALL

Best Korean BBQ Near Me - January 2021: Find Nearby … - Yelp

Search domain www.yelp.com/nearme/korean-bbqhttps://www.yelp.com/nearme/korean-bbq

Find the best Korean BBQ near you on Yelp - see all Korean BBQ open now and reserve an open table. Explore other popular cuisines and restaurants near you from over 7 million businesses with over 142 million reviews and opinions from Yelpers.

A 8,060.00 Chandlier link: https://www.build.com/allegri-11780/s890176

1 in stock CHROME

from the Quantum Quadro Collection

Allegri 11780 - Build.com

Search domain www.build.com/allegri-11780/s890176https://www.build.com/allegri-11780/s890176

Save up to 50% on the Allegri 11780 from Build.com. Low Prices + Fast & Free Shipping on Most Orders. Find reviews, expert advice, manuals & specs for the Allegri 11780.

MAY BE A WAY TO COMMUNICATE about software?

a link to ask and answer developers about BUGs in tech code and software quality

a stack eexchange network

with all sorts of links like:

Security implications of granting non-root access to privileged ports (<1024)

https://sqa.stackexchange.com/questions/11780/what-should-qa-ask-developers-they-are-interviewing

Software Tester Job Interview: Case studies on Test Design

>>12311005

It’s so tiring to always be in damage control mode for my lib acquaintances.

You scared, AJ?

Nothing to see here.

cope faggot.

Be careful who you follow, anon. Michelle Malkin:

https://twitter.com/michellemalkin/status/1245853793780002824?lang=en

Anonymous ID: a29ff6 Jan. 4, 2021, 9:22 a.m. No.12311267 🗄️.is 🔗kun >>1290

>>12311240

The Remedial Reading Room is down the hall.

I don't teach dummays.

Anonymous ID: 193173 Jan. 4, 2021, 9:23 a.m. No.12311268 🗄️.is 🔗kun >>1526

and this

may be nothing

The Knox School - Our Home Beside the Shore

Search domain www.knoxschool.orghttps://www.knoxschool.org

Join us on Saturday, November 14th at 7:30 PM for The Knox School's Virtual Production of Qui Nguyen's She Kills Monsters She Kills Monsters tells the story of Agnes Evans…

Field Office Locator | SSA

Search domain www.ssa.gov/locator/www.ssa.gov/locator/

Looking for a local office? Use one of our online services and save yourself a trip!

FLORIDA COMES UP???

11780 Seaview Dr, Vero Beach, FL 32963 | 23 Photos | MLS …

Search domain www.movoto.com/home/11780-seaview-dr-vero-beach-fl-32963-pid_1s0q67q8ahhttps://www.movoto.com/home/11780-seaview-dr-vero-beach-fl-32963-pid_1s0q67q8ah

11780 Seaview Dr Vero Beach, FL 32963 is located in the Indian River and the nearest school is Sebastian River High School. an ideal family neighborhood with Sebastian River High School highly rated assigned schools. Discover more about the Vero Beach. As of today, there are 337 properties listed for sale in ZIP code 32963 and 1,013 properties

Jason Vorhees, ID: c6cd29 Jan. 4, 2021, 9:23 a.m. No.12311269 🗄️.is 🔗kun >>1317

>>12311253

bugaboo,

Anonymous ID: f5d86c Jan. 4, 2021, 9:23 a.m. No.12311270 🗄️.is 🔗kun >>1278

>>12311154

I tried to watch this movie.

Unsuccessful.

It's a Cherokee new year prayer anon

Anonymous ID: 4c76f7 Jan. 4, 2021, 9:23 a.m. No.12311273 🗄️.is 🔗kun >>1314

>>12311239

>is he trying to dictate the terms of their engagement?

She. DC mayor made request.

>>12311266

She can be wrong about Jared Kushner and right about Paul Ryan.

sometimes it passes by and camouflages itself like a bot….

and at 5km depth too

Tyndall AFB

Anonymous ID: 193173 Jan. 4, 2021, 9:23 a.m. No.12311277 🗄️.is 🔗kun >>1526

CHINESE SHIT:

We believe in Star/Voice supremacy

salem9, Dec 17, 2020

Discussion in 'K-POP' started by salem9, Dec 17, 2020.

LOONA's comeback would've been waaay bigger if …

Search domain www.allkpop.com/forum/threads/loonas-comeback-wouldve-been-waaay-bigger-if.523092/https://www.allkpop.com/forum/threads/loonas-comeback-wouldve-been-waaay-bigger-if.523092/

JYPE H.Q. nuff-nuffs-nice said: … 11,780. They would have flopped no matter what. At least they sold some albums. Meh #9 atropos, Dec 17, 2020. hamsin5 likes this. FatesSoneCardi Public Figure.

https://www.allkpop.com/forum/threads/loonas-comeback-wouldve-been-waaay-bigger-if.523092/

DO YOU SEE 11,780 Q ANYWHERE IN THIS LINK THAT COMES UP FOR RAM STORAGE?

WHY DOES THIS PHONE COME UP??????

MI Poco M2 (Pitch Black, 6GB RAM, 64GB Storage): Amazon.in …

Search domain www.amazon.in/MI-Poco-Pitch-Black-Storage/dp/B08JCSS94Shttps://www.amazon.in/MI-Poco-Pitch-Black-Storage/dp/B08JCSS94S

16.59 cm (6.53 inch) Full HD+ Display 13MP + 8MP + 5MP + 2MP | 8MP Front Camera 5000 mAh Lithium Polymer Battery MediaTek Helio G80 Processor POCO M2 Has 6.53 inch display with resolution of 1080x2340 it has 2GHz+ 1.8GHz Dual plus Hexa Core Media Tek Helio G80 Processor, 5000 mAh LI-Polymer Battery, 18W of Quick Charge Android V10(Q) Operating System Dual GSM+GSM Sim , nano+nano , 4G VoLTE …

https://www.amazon.in/MI-Poco-Pitch-Black-Storage/dp/B08JCSS94S

>>12311270

I've lived that movie,

>>12311245

Kamala called me a racist but cmon man, she aint black

>>12311271

fuck off tom

Allegory of the Cave Analogy

If my culture were trapped watching shadow puppets, and I wanted to predict our ability to escape the cave, one metric of key concern is percentage of population satisfied with the shadows vs those straining to see elsewhere.

In this way, comparing the public’s social media interaction with Lin Wood vs MSM is interesting.

Images related.

>>12311258

think he was being facetious,

satirizing what (((they))) do

Anonymous ID: 193173 Jan. 4, 2021, 9:24 a.m. No.12311283 🗄️.is 🔗kun >>1526

AND THIS

ContentDialog ignoring CanExecute

"This seems like a bug, but seeing it hasn't been changed since '14, I'm wondering if this design is intentional."

ContentDialog ignoring CanExecute - Microsoft Q&A

Search domain docs.microsoft.com/answers/questions/11780/contentdialog-ignoring-canexecute.htmlhttps://docs.microsoft.com/answers/questions/11780/contentdialog-ignoring-canexecute.html

Welcome to our Microsoft Q&A platform! From the style of ContentDialog, there is a Button named PrimaryButton which represents PrimaryButton. It has bound Content, IsEnabled property, etc, but doesn't bind Command property, it should be why CanExecute has no effect. So you can use TemplateBinding to bind PrimaryButtonCommand with Command.

https://docs.microsoft.com/en-us/answers/questions/11780/contentdialog-ignoring-canexecute.html

DO YOU SEE ANYTHING THAT SAYS 11,780 Q ? BUT THIS COMES UP

Home - St. James Rehabilitation and Healthcare Center

Search domain stjamesrehab.comstjamesrehab.com

St. James Rehabilitation and Healthcare Center provides unprecedented levels of genuine care and customer service for our communities' Rehabilitation and Nursing needs, in a soothing, tranquil and state-of-the-art environment.

http://stjamesrehab.com/

https://www.spotangels.com/washington-dc-parking

>>12311274

or right about both

Notables Are Not Endorsements

#15715

>>12310914 Bobby Piton insinuating a fake MSM hit piece coming out on him

>>12310905, >>12310924 John Cardillo is unhinged because of Lin Wood

>>12310973 It’s a Planned Panic-demic.`

>>12311007, >>12311010 Shadow strike.

>>12311080 Cheap hair lice drug may cut risk of COVID-19 death by 80 percent: study

>>12311089 How the fake news industry manufactures hoaxes

>>12311096, >>12311139 The 1973 Home Rule Act

>>12311098 Congress Approves Rules Regulating Jan. 6 Electoral Vote Count

>>12311160 Mayor BOWSER has no authority over DC NG. That power belongs to President Trump only due to DC's unique status.

>>12311215 Video Of Dems Objecting to Electoral College Votes

>>12311229 Anon advice DC Travel

>>12310921, >>12311021 pf

>>12311284

anon, perfect.

Anonymous ID: a1b27b Jan. 4, 2021, 9:25 a.m. No.12311288 🗄️.is 🔗kun >>1302

>>12311285

Or not right about one and right about the other.

Evidence?

Anonymous ID: 748849 Jan. 4, 2021, 9:25 a.m. No.12311290 🗄️.is 🔗kun >>1300

>>12311267

Those who can't present evidence result to insults

>>12311272

interesting,

you & others, ppl poppin they heads out th sand,

nice to see that ppl know what they lookin at,

Anonymous ID: 2234b7 Jan. 4, 2021, 9:25 a.m. No.12311292 🗄️.is 🔗kun >>1312

>>12311272

very beautiful

Anonymous ID: 193173 Jan. 4, 2021, 9:25 a.m. No.12311293 🗄️.is 🔗kun >>1526

again

some may be nothing

but a lot is in between the

different links that populate

OR THIS

Audi of Smithtown | Audi Dealership in Smithtown, NY

Search domain www.audiofsmithtown.comhttps://www.audiofsmithtown.com

Audi of Smithtown in St. James, NY treats the needs of each individual customer with paramount concern. We know that you have high expectations, and as a car dealer we enjoy the challenge of meeting and exceeding those standards each and every time.

https://www.audiofsmithtown.com/

Operators Manuals | Lincoln Electric

11780

IM10096

POWER MIG 256 - 11780

Search domain www.lincolnelectric.com/en-us/support/Pages/operator-manuals.aspx?type=code&q=11780https://www.lincolnelectric.com/en-us/support/Pages/operator-manuals.aspx?type=code&q=11780

Product Names and Code Numbers can be found on the name plate of welders and wirefeeders. In order to ensure you have the correct Operator's Manual for your machine you must use a Code Number Search.

https://www.lincolnelectric.com/en-us/support/Pages/operator-manuals.aspx?type=code&q=11780

Laqjuana Houser in Redford, MI - Bizapedia Profile

Search domain www.bizapedia.com/people/michigan/redford/laqjuana-houser.htmlhttps://www.bizapedia.com/people/michigan/redford/laqjuana-houser.html

Laqjuana Houser is listed as an Agent with Q's Raw Smoothies LLC in Michigan. The address on file for this person is 11780 Columbia, Redford, MI 48239 in Wayne County. The company is a Michigan Domestic Limited-Liability Company, which was filed on March 12, 2018.

Words That Rhyme With 11780 - Rhymes.net

Search domain www.rhymes.net/rhyme/11780https://www.rhymes.net/rhyme/11780

This page is about the various possible words that rhymes or sounds like 11780. Use it for writing poetry, composing lyrics for your song or coming up with rap verses. 11780 is the US ZIP code of Nesconset, Head of the Harbor, St. James, Smithtown, Stony Brook, Nissequogue - New York …

11780 Wellsley Way, Alpharetta, GA 30005 - Townhouse for …

Search domain www.apartments.com/11780-wellsley-way-alpharetta-ga/q9v0mxy/https://www.apartments.com/11780-wellsley-way-alpharetta-ga/q9v0mxy/

About 11780 Wellsley Way Alpharetta, GA 30005. Fabulous 3 sided brick townhome with 3 bedrooms and 3.5 baths, plus a two car attached garage. Chef's kitchen boasts granite countertops & wood floors all overlooking the dining area & fireside great room.

CHINESE YOUTUBE VIDEO GAME RECORDING

Pikmin 3 Deluxe: Side Stories - Day 1: Flower Garden 11780 …

Search domain www.youtube.com/watch?v=cMqDRH4q5-8https://www.youtube.com/watch?v=cMqDRH4q5-8

So the side stories do not seperate single and co op on the leader board. Oh well, still fun to run but about 24 seconds from WR on the board.

>>12311226

>>12311244

>>12311271

Inbox: Georgia secretary of state's office to hold press conference Monday at 3 P.M.

https://twitter.com/joshdcaplan/status/1346144530874175489

>>12311239

Who is 'he'? The mayor of DC is the nigger lesbian wife of Donna Brazile.

Anonymous ID: 07d1f1 Jan. 4, 2021, 9:25 a.m. No.12311297 🗄️.is 🔗kun >>1322

>>12311266

this chick looks like her head got squished at birth

I have nothing against Kushner, so she is wrong there.

I hear a lot of hate, waiting for the proof. Muhjoo is not enough - never is.

-*---

>>12311126

>Precipice

>–Press Appease

>—Press app ice…(!)

Yeah, that's how this works… homonyms

Fuck's sake

Anonymous ID: a29ff6 Jan. 4, 2021, 9:25 a.m. No.12311300 🗄️.is 🔗kun >>1412

>>12311290

those who are lazy ask others for evidence. Do your own fucking research. Convince yourself. I don't give a fuck what you believe.

Anonymous ID: 9cb40c Jan. 4, 2021, 9:25 a.m. No.12311301 🗄️.is 🔗kun >>1319

>>12311274

Precisely. As a matter of fact, that's exactly how the game is played.

Anonymous ID: 3bb08e Jan. 4, 2021, 9:26 a.m. No.12311302 🗄️.is 🔗kun >>1319

>>12311288

not sure that's an option, anon

>>12311248

I hope you're right.

Commas before Conjunctions, Anons?

What's the consensus?

I might know already, but I'd like (you)'re opinions.

>>12311295

"POTUS was mean to us fraudsters, he told us to manufacture votes"

>>12311159

huomosplaination of how xi ping hurt the mis gendered demonrat or repugnant bad cop good cop neo con - all traitors

Anonymous ID: 91b08e Jan. 4, 2021, 9:26 a.m. No.12311308 🗄️.is 🔗kun >>1325

>>12311281

I have hope

Though a lot of people are watching the shadows, It's hard to think of any period in history where more people have escaped that cave worldwide.

>>12311296

are there restrooms at DC city hall open to the public?

>>12311248

Can't wait for this revelation.

Bring it!

>>12311272

Been researching since oct 2017

Anonymous ID: 9c9792 Jan. 4, 2021, 9:26 a.m. No.12311312 🗄️.is 🔗kun >>1320

>>12311292

Anonymous ID: 193173 Jan. 4, 2021, 9:26 a.m. No.12311313 🗄️.is 🔗kun >>1526

11,780 Q as the search :

https://www.questdiagnostics.com/home/physicians/testing-services/condition/genetics/

Genetic testing : Genetics - Quest Diagnostics

Search domain www.questdiagnostics.com/home/physicians/testing-services/condition/genetics/www.questdiagnostics.com/home/physicians/testing-services/condition/genetics/

QNatal® Advanced, an automated cfDNA noninvasive prenatal screening assay, demonstrates excellent performance characteristics, high positive predictive values, and very low "no-call" rates.Its validated technology delivers accurate results with clear positive or negative reporting for chromosomal abnormalities.

A Review of United States Air Force and Department of Defense Aerospace Propulsion Needs

https://www.nap.edu/read/11780/chapter/10

MyNAP members save 10% online.

Login or Register to save!

Rocket and air-breathing propulsion systems are the foundation on which planning for future aerospace systems rests. A Review of United States Air Force and Department of Defense Aerospace Propulsion Needs assesses the existing technical base in these areas and examines the future Air Force capabilities the base will be expected to support. This report also defines gaps and recommends where future warfighter capabilities not yet fully defined could be met by current science and technology development plans.

Anonymous ID: b871f9 Jan. 4, 2021, 9:26 a.m. No.12311314 🗄️.is 🔗kun >>1383

>>12311273

thx.

I hate wasting bread, but it seems rude not to reply.

Anonymous ID: 327bc8 Jan. 4, 2021, 9:26 a.m. No.12311315 🗄️.is 🔗kun >>1339

Hey Q, could we get a little of pic-related, for old times sake?

https://spothero.com/washington-dc-parking

>>12311269

gay fags

Firing Squads

>>12311301

What game?

>>12311302

Pretty sure it is. After all, Stalin once said 2+2=4 yet he was also wrong about stuff.

It's possible as an option.

>>12311312

>>12311309

can always go "san francisco" style

>>12311297

>Muhjoo is not enough - never is.

-******/////

Anonymous ID: 193173 Jan. 4, 2021, 9:27 a.m. No.12311324 🗄️.is 🔗kun >>1331

11,780 Q as the search

ZIP Codes(0.00 / 0 votes)Rate this definition:

11780

11780 is the US ZIP code of Nesconset, Head of the Harbor, St. James, Smithtown, Stony Brook, Nissequogue - New York

>>12311308

big time,

using all those in th past to give us hindsight,

>>12311225

Gonna be sunny and a high of 45 degrees. Patriotic "neck gaiters" or any type would be ideal as they'd keep you warm and you can just pull them up as "masks" if needed.

https://forecast.weather.gov/MapClick.php?lat=38.89&lon=-77.02#.X_MhGGjYrrc

Anonymous ID: a29ff6 Jan. 4, 2021, 9:28 a.m. No.12311327 🗄️.is 🔗kun >>1402

>>12311309

>are there restrooms at DC city hall open to the public?

only for democrats (i.e., deviants, and antifa)

HER COUSIN WAS KIDNAPPED AND NEVER FOUND. SHE KNOWS that was a signal to her so not say anything. Malkin KNOWS about the trafficking. I am sure that was why they kidnapped her cousin

Anonymous ID: 1e91c9 Jan. 4, 2021, 9:28 a.m. No.12311329 🗄️.is 🔗kun >>1356

Anonymous ID: 8d2e41 Jan. 4, 2021, 9:28 a.m. No.12311330 🗄️.is 🔗kun >>1369

>>12311296

PISS ON THE BOW WOW BOWSER AND HER KHUNT BUFFALO COW BRAZILLE

AND PISS AND SHIT ON THE COPS PROTECTING THE TRAITORS

THAR FAR WORSE THAN THE TRAITORS

crying - 'oh give us respect, don't shoot us in the head…, - as they stand down for p00 p00 and let blm and antifa butt uck em in the arse

>>12311324

11.780 Q as the search:

What does 11780 mean?

Definitions for 11780

11780

Here are all the possible meanings and translations of the word 11780.

Numerology

Chaldean Numerology

The numerical value of 11780 in Chaldean Numerology is: 0

Pythagorean Numerology

The numerical value of 11780 in Pythagorean Numerology is: 0

Images & Illustrations of 11780

easiest classes to take when starting back in college after being gone for a while?

Anonymous ID: 9cb40c Jan. 4, 2021, 9:28 a.m. No.12311333 🗄️.is 🔗kun >>1340

>>12311319

>What game?

Information warfare, anon.

>>12311321

>can always go "san francisco" style

Anonymous ID: 0cdb7d Jan. 4, 2021, 9:28 a.m. No.12311335 🗄️.is 🔗kun >>1370

Tyndal is a city in south dakota

tyndal afb is in florida?

>>12311317

I take that as sarcasm,

you one my friends,

>>12311246

Bingo..

Anonymous ID: 3bb08e Jan. 4, 2021, 9:28 a.m. No.12311338 🗄️.is 🔗kun >>1346

>>12311319

5:5 anon misread previous

Anonymous ID: f56d94 Jan. 4, 2021, 9:28 a.m. No.12311339 🗄️.is 🔗kun >>1351

>>12311315

kek - That one's near the top of the Best of Gifs Non-Titty division, Anon.

>>12311333

Be more specific anon.

"Information warfare" is a given.

Anonymous ID: 07d1f1 Jan. 4, 2021, 9:28 a.m. No.12311341 🗄️.is 🔗kun >>1360

>>12311281

to escape a cave, you need light

Anonymous ID: b291cb Jan. 4, 2021, 9:29 a.m. No.12311343 🗄️.is 🔗kun >>1354

Cuomo with a Pedo bracelet on?

Anonymous ID: dcb9e0 Jan. 4, 2021, 9:29 a.m. No.12311344 🗄️.is 🔗kun >>1359

*—-

Rigging elections, a family business.

>>12311338

No worries, I do that all the time.

How many Christian people did you save under his watch, Anon?

Anonymous ID: 841da3 Jan. 4, 2021, 9:29 a.m. No.12311348 🗄️.is 🔗kun >>1400

My 14 year old and his friend just told me there is a school sponsored satanic club at school

Pelosi had this creature with Covid travel to D.C to vote for her

https://twitter.com/breitbartnews/status/1346145805506392075?s=21

Anon's… trying my best not to be a concernfag, but something has GOT to come out quick and with a huge boom. I've been around for over 2 years, red pilled I couldn't count how many over the years. I am holding strong in faith, but I'm seeing daily A LOT of people just jumping ship and saying "OH WELL, yeah he stole it, but what can we do about it." and just simply don't care. People are starting to to accept that Biden actually won, and it's disheartening. I'm in a HEAVILY red state and area as well. Just doesn't make sense.

>>12311339

Thx, had to throw that one together myself by hand

>>12311332

start with Logic and maybe you'll get the last conservative instructor

General as he was, I don't trust him.

But I'm gong to need a sauce on this

>>12311343

11,780 Q as the search

ZIP Codes(0.00 / 0 votes)Rate this definition:

11780

11780 is the US ZIP code of Nesconset,

Head of the Harbor,

'''St. James, Smithtown,

Stony Brook, Nissequogue - New York

>>12311329

the only solution for misgendered is to have a lobotomy

no need to thank me for the solution, just go ahead with the procedure

>>12311332

Gender Studies - just bring your hatred of White Men to class and you'll ace it.

Anonymous ID: 2c08a3 Jan. 4, 2021, 9:30 a.m. No.12311358 🗄️.is 🔗kun >>1389

>>12311256

"…cook book"? See, that's a big mistake! The Bible could NOT have been constructed by human intellect…it's not possible! Scientific proof, ←– Right There!

>>12311344

>>12311341

>>12311211

Snark aside

Mexico Offers Political Asylum to Julian Assange After UK Judge Blocks US Extradition

Mexico’s President Andres Manuel Lopez Obrador said during his daily press briefing that Mexico is prepared to offer political asylum to WikiLeaks founder Julian Assange.

The offer comes shortly after UK Judge Vanessa Baraitser denied an extradition request by the US government on the grounds that Assange would not be prevented from committing suicide in our prison system.

The US prosecutors have 14 days to appeal the judge’s decision and has said that they plan to do so.

“I’m satisfied that Mr. Assange has the intellect and determination to circumvent the suicide prevention measures, as Professor Kopelman posted, Mr. Assange would not only find a way to suicide, but he it will be executed with the single-minded determination of his ASD/Asperger’s,” the judge said in her ruling on Monday. “Facing conditions of mere total isolation, and without the protective factors which mitigate his risks at HMP Belmarsh, I am satisfied that the US procedures would not prevent Mr. Assange from committing suicide.

“For those reasons, I’ve decided that extradition would be oppressive by reason of Mr. Assange’s mental health and I order his discharge under section 91 of the extradition act 2003. The United States has 14 days to appeal,” the judge concluded.

President Obrador called for Assange to be released last January, to end his torture in detention.

“I don’t know if he has recognized that he acted against rules and norms of a political system, but at the time these cables demonstrated how the world system functions in its authoritarian nature,” Lopez Obrador said in response to a question about Assange at a regular government news briefing last year. “Hopefully consideration will be given to this, and he’s released and won’t continue to be tortured.”

Assange’s lawyers are attempting to get him released from prison now, despite the appeal window, and a bail hearing has been set for Wednesday.

https://www.thegatewaypundit.com/2021/01/breaking-mexico-offers-political-asylum-julian-assange-uk-judge-blocks-us-extradition-video/

>>12311285

wonder if Jared's dad got a pardon so he could testify against him in court ?

wtf is this?

Man, her eyes look full of hatred.

Anonymous ID: 1e91c9 Jan. 4, 2021, 9:30 a.m. No.12311366 🗄️.is 🔗kun >>1466

"On his watch" ← tell tale sign of a shill

>>12311225

That is what I have done, and have only been told to pull it up twice. Once at a bank, and another time in a gift shop that I ended up being thrown out of anyway when they refused my disease-ridden cash and I told the woman she was crazy.

Anonymous ID: 193173 Jan. 4, 2021, 9:30 a.m. No.12311368 🗄️.is 🔗kun >>1526

11.780 Q as the search:

What does 11780 mean?

Definitions for 11780

11780

Here are all the possible meanings and translations of the word 11780.

Numerology

Chaldean Numerology

The numerical value of 11780 in Chaldean Numerology is: 0

Pythagorean Numerology

The numerical value of 11780 in Pythagorean Numerology is: 0

Images & Illustrations of 11780

Anonymous ID: aee2a0 Jan. 4, 2021, 9:30 a.m. No.12311369 🗄️.is 🔗kun >>1430

>>12311330

DC COPS are always dirty sacks of shit. that has never been a secret. dont be nice to them and dont try getting photo ops while there, because they are dirty fucking cops. all of them.

Anonymous ID: f08cb6 Jan. 4, 2021, 9:31 a.m. No.12311370 🗄️.is 🔗kun >>1388

>>12311335

The South Dakota Tyndall has two 'l's. My birth town. Population of about 200 farmers. No military base anywhere around. .

DOW WAS DOWN ALMOST 800 POINTS TODAY

I WONDER WHAT HABBENS IF DEMOCRATS STEAL THE TWO SENATE SEATS TOMORROW??

>>12311362

>Mexico Offers Political Asylum to Julian Assange After UK Judge Blocks US Extradition

notable in last bread

Anonymous ID: 9cb40c Jan. 4, 2021, 9:31 a.m. No.12311375 🗄️.is 🔗kun >>1487

>>12311281

Having the same observances since the start of COVID. It really fucked a lot of people's heads up, and @POTUS' "self-disccovery" and "Q" operation hasn't penetrated the public psyche enough. It's done a very good job, but it needs some real mainstream pushes to get people to buy it all.

This isn't going to end in the next 4 years until something very public and convincing happens. That isn't going to happen until backchannels are no longer necessary.

Anonymous ID: 193173 Jan. 4, 2021, 9:31 a.m. No.12311376 🗄️.is 🔗kun >>1526

11,780 Q as the search:

https://www.viator.com/tours/Mornington-Peninsula/2-hour-Snorkel-with-the-Seals/d22999-11780P9

'2 hour Snorkel with the Seals

3 Reviews

|

Sorrento, Australia

Share

from $62.64

Lowest Price Guarantee

Select Date and Travelers

Saturday, Jan 9, 2021

Number of travelers

the biggest problem we face and will always face is the ministry of truth (mainstream news). my trump supporting relative, who for whatever reason watches nbc, is now wishing he would just shut up and let biden transition. no matter how much you try to explain to them without going too far down the rabbit hole, they don't care. the news cycle is constantly beating into your head "president elect biden's victory", "trumps disgraced loss", "debunked conspiracy theories about voting fraud", "baseless claims about vote rigging".

it will be some twilight zone shit if/when the news ever reports the truth when it starts to come out.

Project Veritas: Warnock Staff Admits Candidate’s Bias Against Police, “Police Officers Are Not All Good…Most of Them Are Bad, WE Know That”

O’Keefe strikes again!

Project Veritas released undercover video of Raphael Warnock’s staff admitting the Democrat Senate candidate’s bias against the police.

The Georgia twin senate runoff election takes place Tuesday, January 5th and the stakes could not be higher.

The Democrats are currently trying to steal both Georgia Senate seats in order to install radical leftists and take control of the Senate.

Georgia Democrat Senate candidate Raphael Warnock is a dangerous Marxist.

“Police officers are not all good, you know what I’m saying? Most of them are bad, WE know that,” Raphael Warnock’s campaign staffer Sasha Williams is heard saying on undercover audio.

Another campaign staffer said Warnock avoids using the phrase ‘defunding the police’ so he doesn’t get attacked, but his goal really is to defund the police.

“He avoids using defunding the police…in reality his whole platform is along the lines of the same people saying defund the police,” another staffer admits to Project Veritas.

WATCH:

https://www.thegatewaypundit.com/2021/01/project-veritas-warnock-staff-admits-candidates-bias-police-police-officers-not-good-bad-know-video/

Revisiting the Kappy Rabbit Hole…….

Isaac Kappy called out Tom Hanks of being a pedophile (Also see: @SaRaAshcraft). This blew up on the internet and even hit some mainstream news outlets…

Hanks never responded, but we all know about his creepy glove pics on Insta.

One specific post showed a picture of a glove with the caption reading:

'Historic Route 66. Roadkill? I hope not! Hanx.'

Dated April 4, 2019 - 39 days before Kappy's death……on Route 66.

Isaac Kappy "jumped" from an overpass on ROUTE 66 near Bellemont, Arizona on May 13, 2019.

The SAME day Kappy "jumped" Hanks posted the red handkerchief pic to his Insta…

A red handkerchief. Within the world of high profile occult murders/suicides, there is the ever-present theme of the “red scarf.”

High profile people are found hanged, often with red scarves, including Kate Spade and L’Ren Scott.

Coincidence it's the SAME day as Kappy's death?

Did you know that the person who hit Kappy's body was named Forest Scott Proctor. (Police Report attached as pic)

Forest???

Like, Forrest (Gump)?? On Route 66???

COINCIDENCE???

THREAD: https://twitter.com/Jhomes551/status/1346140916168404993

>>12311371

>DOW WAS DOWN ALMOST 800 POINTS TODAY

>I WONDER WHAT HABBENS IF DEMOCRATS STEAL THE TWO SENATE SEATS TOMORROW??

>>12308395 (pb)

>>12309896 (pb)

There is a particular dimwitten anon here that completely misunderstood my earlier post here.

I never said that footage like this does not exist.

I said learn to use your brain and exercise discernment.

Until yesterday I would have guessed LW's sauce must be solid, trust Lin. Why else would he say something like that.

But now Lin says that origin of the sauce is lizard squad, people who were convicted in the past and possibly offered leniency in return for becoming assets for our three letter agencies.

Sauce like this is either released by white hats or black hats, nothing else makes sense to me, since information like this will be well guarded. So either white hats used lizard squad -Kappy -> LW as a vector to get it out or black hats did. In the second instance it would serve as a means to muddy the waters and introduce fake footage to discredit the real footage.

If you ask me which alternative is most likely, today I tend to chose the latter, yesterday I would have guessed the first.

Credibility is everything in information warefare, I rather exercise caution in this case.

I used to get shit from anons for pointing out that the narrative LW points out seems to be correct even if little details might be wrong (for instance whether JR's children were adopted from Wales vs. Ireland), but now I absolutely urge anons to stay extra skeptical because if all of a sudden clips emerge and it turns out they are fake, it's going to be hard to later introduce the real evidence and convince the public that this is really going on.

In God we trust. Amen.

>>12311314

Pretty sure it's only wasted when shills do it.

We don't have to mail our votes anymore, since it is safe enough for them!!

>>12311317

Anonymous ID: 8169a2 Jan. 4, 2021, 9:31 a.m. No.12311386 🗄️.is 🔗kun >>1391

I'm beginning to think one of the purposed for Wood's tweets is to lure out the ones having pretended to be "white hats".

>>12311350

>not to concernfag but

Proceeds to concernfag

Big brain move right there

Anonymous ID: 0cdb7d Jan. 4, 2021, 9:32 a.m. No.12311388 🗄️.is 🔗kun >>1456

>>12311370

whats underground there I wonder

Jason Vorhees, ID: c6cd29 Jan. 4, 2021, 9:32 a.m. No.12311389 🗄️.is 🔗kun >>1524

>>12311358

Yehuda ain't so weak that he can't

manipulate a human's ways or words,

Anonymous ID: 193173 Jan. 4, 2021, 9:32 a.m. No.12311390 🗄️.is 🔗kun >>1526

11,780 Q as the search:

https://www.almexperts.com/images/Photoweb/140991_11780_11G_25085_ResumePath.pdf

RONALD G. QUINTERO, CPA, CFA, ABV, CDBV, CFE,

CFF, CIRA, CMA, CTP

Managing Director • Chartered Capital Advisers, Inc.

245 Park Avenue, 39th Floor • New York, NY 10167

(212) 327-0200 • (212) 327-0225 FAX • q@charteredcapital.com

www.charteredcapital.com

Professional Activities

 Served more than 750 public and private clients

of all sizes in a broad range of industries

Areas of Expertise

 Valuations of businesses, financial instruments, and

intangible assets

Italian Holiday Voucher Boosted Domestic Tourism | .TR

Search domain www.tourism-review.com/holiday-voucher-boosted-domestic-tourism-in-italy-news11780https://www.tourism-review.com/holiday-voucher-boosted-domestic-tourism-in-italy-news11780

Domestic tourism supported by holiday voucher in Italy. In a summer that has been further from typical due to the coronavirus pandemic, Italy has been able to boost domestic demand in an effort to offset the drop in international arrivals.

>>12311386

meant "purposes"

Thank You Baker!

o7

>>12310159 lb

Is the hacked Comet Ping Pong menu real?

Legitimate sauce for it?

Anonymous ID: 1ed846 Jan. 4, 2021, 9:32 a.m. No.12311394 🗄️.is 🔗kun >>1418

OTD

Crossed swords

in 1878 the

Flag of Russia

Russian Army liberated #Sophia

Flag of Bulgaria

from #Ottoman troops.

The citizens of the #Bulgarian capital met #Russians with enthusiasm. The liberation of Sophia brought the #Slavic nations closer to the long-sought freedom from the Ottoman yoke

https://twitter.com/mfa_russia/status/1346072515303657472

Night Shift work.

Asking for moar names.

Good or Bad?

The covid lockdowns were to condition normies, and put everything in place, for the martial law that will be needed when half of Congress is arrested; yes or no?

Anonymous ID: 2fbba3 Jan. 4, 2021, 9:32 a.m. No.12311397 🗄️.is 🔗kun >>1551

Deep fakes just mentioned on the floor of the House

>>12311274

or right about Jared. have we not learned anything from the jew shill, we do know that there is no denying that they stick together in the destruction of the "goy" of that I am sure. I HOPE she is wrong about Kushner. I do try to like him and the more I watch his interviews, I think I do like him.

but still. be cautious

Anonymous ID: f56d94 Jan. 4, 2021, 9:33 a.m. No.12311399 🗄️.is 🔗kun >>1447

>>12311350

> A LOT of people just jumping ship and saying "OH WELL, yeah he stole it, but what can we do about it."

BLACKPILL: many such cases

I'm experiencing the same thing, Anon.

The Precipice is super narrow af at this point - something has to break soon.

>>12311348

What state anon? Did the same in my area. My bro is a pastor went to the school and used this as a pretense to set up a Christian club. Eventually the satan club was BTFO. Christian club remains.

>>12311364

NPC escapee from DOOM v1.21

Anonymous ID: a3f4a4 Jan. 4, 2021, 9:33 a.m. No.12311402 🗄️.is 🔗kun >>1415

>>12311327

BREAKING: Mexico Offers Political Asylum to Julian Assange After UK Judge Blocks US Extradition (VIDEO)

https://www.thegatewaypundit.com/2021/01/breaking-mexico-offers-political-asylum-julian-assange-uk-judge-blocks-us-extradition-video

>>12311379

k. so.

if the death of that young man who worked for Loefller was a hit, isn't Wood concerned?

Anonymous ID: 393213 Jan. 4, 2021, 9:33 a.m. No.12311405 🗄️.is 🔗kun >>1436

>>12311362

Trump's biggest stain was not pardoning this fellow.

disgusting.

Anonymous ID: 193173 Jan. 4, 2021, 9:33 a.m. No.12311406 🗄️.is 🔗kun >>1526

11,780 Q as the search:

https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PRK11780

Conserved Protein Domain Family

PRK11780

Entrez CDD Structure Protein Help

COVID-19 is an emerging, rapidly evolving situation.

Get the latest public health information from CDC: https://www.coronavirus.gov

Get the latest research information from NIH: https://www.nih.gov/coronavirus

Find NCBI SARS-CoV-2 literature, sequence, and clinical content: https://www.ncbi.nlm.nih.gov/sars-cov-2/

?

PRK11780: PRK11780 Download alignment

isoprenoid biosynthesis glyoxalase ElbB

Links?

Source: PRK

Taxonomy: Bacteria

Protein: Representatives

Specific Protein

Related Protein

Related Structure

Architectures

Superfamily: cl00020

Statistics?

Structure?

PRK11780 is a member of the superfamily cl00020.

Sequence Alignment

include consensus sequence ?

Format:

Hypertext

Row Display:

up to 10

Color Bits:

2.0 bit

Type Selection:

the most diverse members

225630924 11 KLKAAVVLSGCGHLDGVEVREAVLSLLVLDQQEVDVKCFAPDINITQVMNHRTKEATK-EK-RNVLVEAARIARGEIYDL 88

299768483 1 MKKVAVILSGCGYLDGSEIRESVLTLLALDTANIEYQIFAPDEPLFHVIDHVSGEINMtER-RNILQEAGRIARGEIFSL 79

126643263 1 -----------–MtER-RNILQEAGRIARGKISSL 22

184159767 1 MKKVAVILSGCGYLDGSEIRESVLTLLALDTVNIEYQIFAPDEPLFHVIDHVSGEINMtER-RNILQEAGRIARGKISSL 79

269958346 1 -MNCAVLLSGCGHMDGSEIRESVLVLLELDRLGVRFQCCAPDIQQCDVVNHVSKSSES-QTaRNILVESARIARGDIVNI 78

56417264 1 -MNCVVLLCGCGHMDGSEVRESVLVLLELDRLGVKFQCCAPDIQQHDVVNHASKSTEN-QT-RNILAESARIARGEVISI 77

222475628 1 -MNCVVLLCGCGHMDGSEVRESVLVLLELDRLGVKFQCCAPDIQQHDVVNHASKSTEN-QT-RNILAESARIARGEVISI 77

88606844 1 -MNCAVLLCGCGHMDGSEIREAVLALLALDSYGINVTCCAPNIKQVDVVDHLSGSTLE-EE-RDIMSESARIARGNVVDP 77

42522181 1 MKKIAVVLSGCGHRDGSEITESVSLLIGLHQAGAEVHCFAPDI-QIPITNHINGEAQG-EK-RSLLTEAARIARGHIQSL 77

239617221 1 -MKAGILLSGCGLGDGTQIEEVMLTYLSLDKYGIDYITFAPNEMQHDVIDHYTEKPQN-EK-RNILIESARIGRGKICDI 77

225630924 89 KEAKAENFDMLVVPGGYGVAKNLSDLAESKDMVTVMPEFERLVSEFFVTKKPIGAICISPAIIVSILsskigkeE-SKVK 167

299768483 80 NQLNENEFDGLLLPGGFGVAKNLSTFAFKGAEARVHSTVASILKAFHQSKKPIGAICISPALLALTF-–GdLHPN 152

126643263 23 DQLNENEFDGLILPGGFGVAKNLSTFAFKGAEARVHGTVASILKAFHQSKKPIGAICISPALLALTF-–GeLHPT 95

184159767 80 DQLNENEFDGLILPGGFGVAKNLSTFAFKGAEARVHGTVASILKAFHQSKKPIGAICISPALLALTFg-eL–HPT 152

269958346 79 KSLRVHEFDMLIVPGGFGVAKNFSNLVSQSGSVVVEDDVNSLIREFHRVRKAIGGVCIAPAIIAAALs--ElVKVK 152

56417264 78 ERVQVHEFDMLIVPGGFGVAKNFSNLVSQSGPVSVIDSVKGLIHQFHRARKAIGGVCIAPAVIAAALs--ElVKVK 151

222475628 78 ERVQVHEFDMLIVPGGFGVAKNFSNLVSQSGPVSVIDSVKGLIHQFHRARKAIGGVCIAPAVIAAALs--ElVKVK 151

88606844 78 KDISPNDFDMLILPGGFGVAKNYSDILKGESPVSVLEEVKQTIVKFHKEKKAIGAICIAPAIVAASLs--SvSKVK 151

42522181 78 DKLHAKDFDAVVFPGGYGAAKNLSNWAEKGAQCEVNPDVKRVILEFHSASKPIGALCIAPVLVAKVLg-dK–KVT 150

239617221 78 REVSCKDIDAIIIPGGLGVFKNLSTFIVDKKSFTVNKNVDDLLKAMYLSKKSIAGICGAVILIAKSLs-qH–VSD 150

225630924 168 VTIG—DDREQLIERLGGEHIKCDTELSIEDEEHNVFSCSAYMRSDeST-YSVYQGIKHMIDSMVKKI 232

299768483 153 ITLGs-dVNTAKEIEKTGSIPHVCQTSSCVVDKQNLFVTTPAYMDDQaGL-KDVFLGITSLVTAMTILA 219

126643263 96 ITLGs-dLNIAKEIEKTGSIHHVCQTSDCVVDKQNLFVTTPAYMDDQaNL-KDIYTGITSLVNTMTALA 162

184159767 153 ITLGs-dLNIAKEIEKTGSIHHVCQTSSCVVDKQNLFVTTPAYMDDQaNL-KDIYAGITSLVNTMTALA 219

269958346 153 VTLG—DDTDGIISRCGGEHVVCPTDGFVVDEENAVFSCSAYMRDD-RL-HRVHLGIQKMVEGMVKFC 216

56417264 152 VTLG—DDADGIISRCGGEHVVCPTDDFVADEKNAVFSCSAYMRDD-TL-HRVHLGIQKMVEGMVKFC 215

222475628 152 VTLG—DDADGIISRCGGEHVVCPTDDFVADEKNAVFSCSAYMRDD-TL-HRVHLGIQKMVEGMVKFC 215

88606844 152 VTLG—EDIDSIISRCGGEHVFCETDDYVADIDMGVFSTPAYMRKD-SL-HKIHVGIHKMVGAMVDFV 215

42522181 151 VTIGd-dAATAAEIEKTGAIHEECPVNDYITDRESKVVTTPAYMYGD-AKpNEVFAGIFGLAHEIVEWA 217

239617221 151 LKVAtanDAYGELLSELNVNAVNCSAKECVIDRKKQSSNYP-RI—SGIQKNGRNYGGY- 206

Citing CDD

Lu S et al.(2020). "CDD/SPARCLE: the conserved domain database in 2020.", Nucleic Acids Res. 48(D1):D265-D268.

Used to be a shitload of Cold War nuclear missile silos in the Tyndall, SD area. Most were emptied out and bought by locals for groovy homes.

There is NOTHING around Tyndall but cornfields and occasional farmhouses.